KEGG   Hevea brasiliensis (rubber tree): 110644357Help
Entry
110644357         CDS       T05150                                 

Definition
(RefSeq) thymidine kinase a-like
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    110644357
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     110644357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 290 aa AA seqDB search
MLTTISRMKSLVSPPFSPIFKATPSSLFFPLPSNFKFLSFPTSLTSSISLSLNPPPMLST
FPIQNRCLHSNSSPSFSSSSGEIHVIVGPMFAGKTTTLLRRIQSESGNGRNVAVIKSNRD
TRYGLDSIVTHDGVKLPCVALPNLSSFRQKFGTDAYEQLDVIGIDEAQFFEDLYDFCREA
ADHDGKTLIVAGLDGDYLRRSFGSVLDIIPLADSVTKLTARCELCGKRAFFTLRKTQETR
IELIGGADVYMPVCRQHYVSGQVVVEAARILLESQKAECGSHMFVPDSSY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttaactactatttcaaggatgaagtctcttgtatctccaccattttcacccattttc
aaggccacaccttcttccctcttcttccctttaccctctaatttcaaatttctctccttt
cccacttctctcacaagttcaatttctctctcccttaatcctcctcctatgctgtcaact
tttccaattcaaaatcgatgtcttcactccaattcctctccctctttttcttcctcctcc
ggagagattcacgttatagttggccccatgttcgctggaaaaaccaccacgcttctccgt
cgcatccagtctgaaagcggcaatggcagaaatgtagcagttataaaatcaaacagggat
acaagatatggtttggattcaatagtgacacatgatggagtgaaactgccatgtgtggca
ctgcctaatttgtcatcatttagacaaaaatttggcactgatgcatatgaacagctggat
gtgattggtattgatgaagcacaattttttgaagacctatacgatttttgtcgtgaagct
gctgatcatgatgggaaaactctaatagttgctggtctggatggtgactatttgaggagg
agttttggttccgtccttgatataattcccctagctgattctgtaactaagttgactgca
cggtgtgaactttgtggaaaacgggccttctttaccttgagaaagacacaggagacacgg
atagaacttattggtggggctgatgtgtacatgcctgtatgtcgacagcattatgtcagt
ggacaagtagttgttgaagctgcaagaattttactagaatctcagaaggctgaatgtggc
tctcacatgtttgtaccagattcttcttactag

DBGET integrated database retrieval system