KEGG   Hevea brasiliensis (rubber tree): 110655096Help
Entry
110655096         CDS       T05150                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110655096
   00051 Fructose and mannose metabolism
    110655096
   00052 Galactose metabolism
    110655096
   00500 Starch and sucrose metabolism
    110655096
   00520 Amino sugar and nucleotide sugar metabolism
    110655096
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110655096
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110655096
Membrane trafficking [BR:hbr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110655096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVMHRMRCSGKWARAMAILREFEEKCGTPSGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVVLGGKDDL
VVKKEFEEVSIPPHLMTGSSDALFDYIAEALAKFVAKEGEGLHPSPGQQRELGFTFSFPV
RQTSIASGNLIKWTKGFSIEDTVGQDVVGELTKAMKRVGLDMRVAALVNDTIGTLAGGRY
CNQDVIAAVILGTGTNAAYVERAQAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDVESLNPGEQIFEKIISGMYLGEIVRRVLLRMAQEADFFGDVVPPKLEIPFILRTPHM
SAMHHDTSSDLKVVGSKLKDILEISNTSLKMRKAIVNLCDIVATRGARLSAAGIVGIIKK
LGRDTVRDGEKQKSVIALDGGLFEHYTKFRISMESTLKELLGEEVSESIVVEHSNDGSGI
GAALLAASHSQYLEVAEA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggtggcggtgggtgcggcggtggtctgtgcggcggctgtctgtgctgcggcg
gcccttgtggtcatgcacaggatgcgctgttcggggaagtgggccagggccatggccata
ctcagggagttcgaggaaaagtgtgggaccccctcaggaaagctacgccaggtggctgat
gctatgaccgttgagatgcatgctggtcttgcatcggagggtggaagcaagcttaagatg
ctcatcagctacgttgacaatcttcccaccggggatgagaaggggctgttttatgcatta
gaccttggtggcacaaattttcgtgttctacgggtggtattgggtgggaaagatgatctt
gttgtcaaaaaagaatttgaggaagtttcaattcctccacacttgatgactggatcttca
gatgctttgttcgattatattgctgaagcacttgctaaatttgttgctaaagaaggtgaa
ggtttgcatccttcgcctggtcaacaaagggaactgggctttaccttctcgtttccagtt
cggcaaacatcaatagcatcaggaaatcttataaaatggacaaaaggcttctccatagag
gacacggttgggcaggatgtggtgggggagttgacaaaagccatgaaaagagttggcctt
gacatgcgtgtggctgctttggtcaatgatacgattggaacattagctggaggtagatac
tgcaaccaggacgttattgctgctgtaatcttgggaactggaacaaatgcagcatatgta
gagcgagcacaagcaattcccaagtggcatggtcttctacctaaatctggagaaatggtt
atcaacatggagtggggtaactttcggtcatcacaccttccattaacagaatatgatcaa
gccctggatgttgagtctctgaaccctggggaacagatttttgagaagataatttctggt
atgtatttgggagagattgtacgcagagttctattgagaatggctcaggaagctgacttc
tttggtgatgttgttccaccaaaactggagattccatttatcttaaggaccccacacatg
tctgcaatgcatcatgatacatcttcagatcttaaagttgttggaagcaaattaaaggat
atcctagagatatcaaatacctccctgaaaatgaggaaagctattgttaacctctgtgat
attgttgccactcgtggtgcccggctatctgctgctggaatcgtaggcatcatcaagaaa
ctgggaagagacacagtgagggatggggaaaagcagaagtcagtaatagcgttggatggt
gggctgtttgagcactatactaaatttcgtatctccatggagagcactctcaaggagttg
ctgggagaggaagtttctgaaagcatcgttgttgagcactcaaatgatggctcaggcatt
ggagcggctctcctggcagcttcccactcccaatacctggaggtcgcagaagcttaa

DBGET integrated database retrieval system