KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_0692Help
Entry
HCBAA847_0692     CDS       T02494                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HCBAA847_0692 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCBAA847_0692 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HCBAA847_0692 (ddl)
Enzymes [BR:hcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HCBAA847_0692 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hcb01011]
 Precursor biosynthesis
  Amino acid ligase
   HCBAA847_0692 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
671163..672200
Genome map
AA seq 345 aa AA seqDB search
MKFDVIFGGVSFEHEISIVSAVALKKVLGERISNFIFLDSLHRFYLIPATLMKSKTFSSG
EYKKCTEIFLQRSSFVKKSLFGFKAIIPNTLISLIHGADGEDGSMSALLDFYHIPFIGPR
IESSVMSFNKALTKIYAQSRGVKVLDHEILTRNSPNPTLPYPLILKPSRLGSSIGVSVVN
KEDELEYAKDLAFEYDDSIVVECFKSGVKEYNLAGCKIGDEFRFSIVEEPSKKEMLDFEN
KYLDFSRTAQVLKADISQELEKQIQQNFAKLYENAFEGALIRCDFFVIDNEVYLNEINPI
PGSMANYLFEDFACVLESLAHNLPKKHSIKVSYKYIERIHHAKGK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatgtaatctttggtggcgtgagctttgagcacgagattagcattgtgagt
gcggtggcgttaaaaaaggtgctaggggagagaatatcaaattttatttttttagattct
ttgcatagattctaccttattcccgcaacgctaatgaagtctaaaacttttagttcaggg
gagtataaaaaatgcacagagatttttttgcaaaggagttcatttgtaaaaaaatctctt
tttggctttaaggcgattatcccaaatacgcttattagccttatacacggagcagatgga
gaagatggcagtatgagtgcgttgcttgatttttatcatattccttttattggtccgcgt
atagaatctagtgtgatgagttttaacaaggctttgacaaagatttacgcacaatcaagg
ggcgtgaaagtgttagatcatgagatactcactcgcaatagccctaatcccactttgccc
tatcctttgattttaaagccatctcgccttggaagctccataggtgtaagtgtagtaaat
aaagaagatgagctagaatatgctaaagatttagcatttgagtatgatgatagtattgtg
gtggagtgctttaaaagcggtgtgaaagaatataatttggctgggtgcaagataggtgat
gagtttagattctctatcgtagaagagccaagtaagaaagaaatgctagattttgaaaat
aaatatttggacttttctcgcacagcacaggttttgaaagctgatattagccaagagctt
gaaaagcagattcagcaaaattttgccaaactttatgaaaacgcttttgagggggcgttg
atccgttgtgatttttttgtgattgataatgaagtgtatttgaatgagattaatcccatt
ccggggtctatggcgaattatttatttgaagattttgcttgtgtgcttgaatctttggct
cataatttgccaaaaaaacattctatcaaggtaagctataaatatattgaacgcattcat
cacgcaaaaggaaagtaa

DBGET integrated database retrieval system