KEGG   Halomonas chromatireducens: LOKO_01817Help
Entry
LOKO_01817        CDS       T04292                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hco  Halomonas chromatireducens
Pathway
hco00010  Glycolysis / Gluconeogenesis
hco00071  Fatty acid degradation
hco00350  Tyrosine metabolism
hco00625  Chloroalkane and chloroalkene degradation
hco00626  Naphthalene degradation
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01130  Biosynthesis of antibiotics
hco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOKO_01817
  Lipid metabolism
   00071 Fatty acid degradation
    LOKO_01817
  Amino acid metabolism
   00350 Tyrosine metabolism
    LOKO_01817
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LOKO_01817
   00626 Naphthalene degradation
    LOKO_01817
Enzymes [BR:hco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LOKO_01817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMD00885
UniProt: A0A0X8HDY9
LinkDB All DBs
Position
complement(1928475..1929503)
Genome map
AA seq 342 aa AA seqDB search
MDKTMKAAVVRQFGEPLAIEEVDVPRPQAGEILVKVAASGVCHTDLHAAHGDWPVKPSPP
FIPGHEGVGHIVAVGQGVKHVKEGDRVGVPWLYSACGYCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADAGFVGLLPDNIDFLEVAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDGKLALAERLGATVTVNALKTDPATYLKQAIGGAHGALV
TAVSPKAFDQAQGMLRRGGTLVLNGLPPGDFPLPIFETVLNGITIRGSIVGTRQDLQESL
DFAGEGKVKATVSTDRLENINDVFQRMIDGKIEGRVVLDMAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggataagacgatgaaagccgccgtggtgcgtcagttcggcgagccgctggccatcgag
gaggtcgacgttccgcggccgcaggctggtgaaatactggtcaaggttgccgcgtcgggg
gtatgtcataccgacctgcatgccgcccacggcgactggccggtcaagcccagcccgccc
ttcattccggggcatgagggcgtgggccatatcgtggcagttggccagggggtcaagcat
gtcaaggaaggtgaccgggtcggcgtgccctggctctattcagcctgcggctactgtgaa
cactgcctgggtggctgggagacgctgtgtgaatcccagcagaatacgggatactcggtc
aacggcggctttgccgactacaccctggcggatgccggcttcgtcgggttattgccggat
aacatcgatttcctcgaggtcgccccggtgctatgtgcgggagtcacggtctacaagggg
ctgaagatgaccgatacccgtccggggcagtgggtggtgatctccggtatcggtggcctg
ggccacatggcagtccagtatgccaaggcgatggggctcaacgtggccgcggtggatatc
gacgatggcaagctggccctggcggaacgcttgggagcgactgtcacggtcaatgcgctc
aagaccgatcccgccacctacctcaagcaggcaatcggtggtgcgcatggagccctggtg
acggcagtatcgcccaaggccttcgatcaggcccagggcatgttgcgtcggggaggcacc
ctggttctcaatggcctgccacccggtgatttccccctgccgatcttcgaaaccgtgctc
aacggtatcaccatccgtggctccatcgtcggtacccgccaggaccttcaggagtcgctg
gatttcgctggagaaggcaaggtcaaggccacggtaagcaccgaccgcctggagaacatc
aacgacgtcttccagcgcatgatcgacggcaagatcgaggggcgcgtggtgctggacatg
gcaagctga

DBGET integrated database retrieval system