KEGG   Halomonas chromatireducens: LOKO_02820Help
Entry
LOKO_02820        CDS       T04292                                 

Definition
(GenBank) Long-chain-fatty-acid--AMP ligase FadD29
Organism
hco  Halomonas chromatireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3014020..3016875
Genome map
AA seq 951 aa AA seqDB search
MERSNRERPTDMTPQQRLLAIIEEMARELQPDRTAPRSPSLQSRLDRDLGLDSLARSELL
LRIEHAFDVKLPEEALMAETPAALLDALQSARGKAAKADAAADPVVETAHEPAATPTTPL
EPVEGEPESAETLNAAMDWHLERHPDRPHLFIYGDDDQPRTLSYGELDRGGRDIAAALLA
RGVEAGDRVALMLPTSPDYFIAFLGILRAGAVPVPIYPPARPAQLEEHLRRHGRILTNAG
AEVLITVPEARRVAHLLRADAPHLGSIVTVAELCDGRDTAAAMTPEGSSLALLQYTSGST
GDPKGVMLTHAQLLANIRAMGKRLEATPEDVFVSWLPLYHDMGLIAAWLASLYYAIPLVV
MSPLSFLSHPLRWLELIQRHRGTIAGSPNFGYELCLRAARPEQLEALDLSSWRIAFNGAE
PVSARTFERFAETLAPCGLHQEALMPVYGLAEAAVGLCVATPGRGVILDAVHREVFATTG
EARPEPDPEAAQTFVNCGPPLPGYSVRIVDPQGEVLPERHEGDIEFRGPSATQGYFNNAE
ESRKLCHGEWLRTGDRGYLADGDIHLSGRRKDVLVRGGRNIYPYDLEEAIGGLEGVRKGC
VAVFGNPNAESGIEELVVVAETHVDDAEERDAITREITSVTVDIVNLPPDDIRLVPPHSV
LKTSSGKIRRGATAERYRSGQLEKGQAPVWRQVTGLALRSALQRWRHGASRAGEWLYAGY
AWAIFGIAMALVALLALPLPRLAWRWRVAHYIARSASLLTGIRTRAHGLARFPHREPCVL
VANHASYLDALILTAVFPYGFHYLAKAELSQPFLTRFVLQRMGVLFVERDNTREANHTTE
KVLQTVRQGGSPAFFPEGTFRPEPGVQDFHMGAFVSAAKAQVAVVPVAIRGSRVLLRGRE
WLPHPGTVDVVVGAPLQPRSSDWSEAVRLRNEARAFIVAESGEPDLGASRA
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttccaaccgcgagcggccgacagatatgacgccacagcagcggctgctcgcc
atcattgaagagatggcccgcgaattgcagccggaccggactgcgccacgctccccgtca
ttgcaatcgcggctggaccgggatctcggcctggacagcctggcccgctccgagctgctc
ctgcgaatcgaacacgccttcgacgtcaagctacccgaagaggccctgatggcggagaca
cccgccgcgctgctggatgcgctgcaaagcgcccggggcaaggccgccaaggcagatgcc
gccgccgacccggtagtggagacggcgcatgaaccggctgctactcccaccaccccattg
gagccggtggagggcgagccggaaagcgccgagacgctcaatgcggccatggactggcac
ctggagcgccaccccgaccggccccacctgttcatctacggcgatgatgaccagccccgg
acgctgagctacggtgaactcgaccggggcggccgagacatcgccgcggcgctgctggcc
cgaggcgtcgaggccggcgaccgggtcgccctgatgctgccgacctcaccggactacttc
atcgccttcctgggcattcttcgcgccggtgcggttccggtacccatctacccgccggca
cggccggcacagctcgaggagcacctgcggcgccatggccgcattctgaccaacgccgga
gcggaagtcctgatcaccgttcccgaagcgcgacgtgtcgcccacctgctgcgcgcagac
gcgccgcacctcgggtccatcgtgacggtggcagagctctgcgacggacgtgacaccgcg
gcggccatgacacctgagggctcgagcctggcgctgctgcagtacacctcaggcagtacc
ggggaccccaagggggtcatgctgacccatgcgcagctgctggccaacatccgtgccatg
ggcaagcggctggaagccacgcccgaggacgtgttcgtcagctggctgccgctctaccat
gacatggggctgatcgcggcctggctcgccagcctctattacgccatcccgctggtggtg
atgtcgccgctctcgttcctgtcgcacccgctgcgctggctggagctgatccagcgccac
cggggcacgatcgccgggtcgcccaatttcggctacgaactctgccttcgtgcagcacgc
ccggagcagctggaggcgctggacctgagcagttggcgcatcgccttcaacggcgccgag
ccggtcagcgctcgcaccttcgagcgctttgccgagacgctggcgccctgcgggctgcac
caggaggccctgatgccggtatacgggctggccgaggccgccgtcgggctctgtgtggcc
acgcccggccgcggcgtgatcctcgacgccgtccaccgcgaggtcttcgccaccaccggt
gaggcccggccggaaccggatcccgaagccgcccagaccttcgtcaactgcggcccgcct
ctacccggctactcagttcgtatcgtcgatccacagggggaagtgctgcctgaacgtcat
gaaggcgacatcgaatttcgcggcccctccgccacccagggttacttcaacaacgccgag
gagagccgcaagctgtgccacggcgagtggctacgcaccggggacaggggctatctcgcc
gatggtgacatccacctcagtggccggcgaaaggatgtcctcgttcgcggtgggcgcaac
atctatccctacgatctcgaggaggccatcggcggtctcgagggagtcagaaagggctgc
gtggcggtattcggcaatcccaatgccgaaagcggcatcgaggaactggtcgtggtggcc
gagacccatgtcgacgacgcagaagagcgggatgcgatcacccgcgagatcaccagcgta
acggtggatatcgtcaacctcccgcccgacgacatacgcctggtaccacctcacagcgta
ctgaagacctcgagcggcaagatccgccgcggtgccacggcagagcgctaccgcagcggg
cagttggaaaagggccaggcgcccgtctggcgacaggtcaccgggctggcgctacgctcg
gccttgcagcgctggcgccatggcgccagccgagccggagaatggctctatgccggctat
gcctgggccatcttcggcattgccatggcgctggtcgccctcctcgccctgcccttgccc
cggctcgcctggcgctggcgagtcgcccactatattgcccgcagcgcctcgctgttgacg
ggcattcgtacccgggcacatggcctggcccgctttccccaccgcgagccctgcgtgctg
gtggccaatcacgccagctacctggacgcgctgattctgacggccgtgttcccgtacggc
tttcactatctggccaaggccgaactcagccagccgtttctcacccggttcgtactccag
cgtatgggcgtgctgttcgtcgagcgcgacaatacgcgggaggccaaccacaccaccgaa
aaggttctccagaccgtccggcaaggcggatcgccggcattctttcccgaaggaaccttt
cggccggagcccggggtgcaggacttccatatgggcgccttcgtctcggccgccaaggcc
caggtagcggtagtaccggtggccattcgagggagtcgtgtgttgctgcgcggcagggag
tggctgccccatcccggcacggtagatgtcgtggtgggcgccccgctccagccccgaagt
tcggactggtccgaagcggtcaggctgcgcaacgaggcccgagcgttcatcgtggcagaa
tccggtgagccagacctgggagccagtcgggcttga

DBGET integrated database retrieval system