KEGG   Hippocampus comes (tiger tail seahorse): 109507468Help
Entry
109507468         CDS       T04969                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00500  Starch and sucrose metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109507468
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109507468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 109507468
NCBI-ProteinID: XP_019712478
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MKRFVVWMLLWGLAAAQHHPQLRHGRTAIVHLFEWRWADIAAECERFLGPNGFGGVQISP
PNEHIVLNNPWRPWWQRYQPVGYNLCSRSGDERELRDMVTRCNNVGVNIYVDAVINHMCG
SAGGEGNHSSCGTWFSASTKNFPDVPYSAWDFNDHKCRTGSGEIENYWDANQVRDCRLVG
LLDLALEKNYVRDKVAEFMNALIDMGVAGFRVDACKHMWPGDLAAVYSRLHNLSTEWFAE
GSRPFIFQEVIDLGGEPISSHEYSHLGRVTEFKYSAKLGTVFRRWHGEKLCYTRNWGEGW
GFMPDGNAVVFVDNHDNQRGHGAGGASIVTFWDPRLYKMAMGYMLAHPYGVTRVMSSFRW
NRHIVNGKDQNDWMGPPSHSDGSTKSVPINPDQTCGDGWVCEHRWRQIKNMVIFRNVVNG
QPHTNWWDNHGNQVAFGRGNRGFIVFNNDNWDLDVTLNTGMPGGTYCDVISGQKEGDMCT
GKQIHVGDDGRAQFRISTQDEDPFVAIHAESKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggttcgtcgtgtggatgctgctctgggggctcgccgccgcccagcaccatcct
caactccggcacggcaggacggccatcgtgcatctcttcgaatggcgctgggcggacatc
gcagcggagtgcgagcgctttttggggcccaacggcttcgggggagttcagatctctcct
cccaacgagcacattgtgctgaacaatccctggaggccatggtggcagaggtaccagccg
gtgggatacaacctgtgttctaggtccggcgatgagcgggagctgcgagacatggtgacg
cggtgcaacaacgtcggcgtcaacatctacgtggacgccgtcatcaaccacatgtgcggg
tcggccggcggcgaggggaaccactcgtcatgcgggacctggttcagcgccagcaccaag
aacttccccgacgttccctacagcgcctgggacttcaatgaccacaaatgcaggacgggc
agcggcgaaatcgagaactattgggacgcaaatcaggtgcgtgactgtcgcctggtgggc
cttctggacctcgccctggagaagaactacgtgcgggataaggtggccgagtttatgaac
gcgctgatcgacatgggcgtggccgggttccgagtggatgcctgcaagcacatgtggccc
ggcgacttggccgccgtctacagccgcctgcacaacctcagcactgagtggttcgcagaa
ggctccagaccgttcattttccaggaggttatcgacctcggaggtgagcctatctcatct
cacgagtactcccatctgggacgggtgaccgagttcaaatacagcgcaaaactgggaacc
gtcttccgaagatggcacggcgagaagttgtgctacaccagaaactggggagaggggtgg
ggtttcatgcccgatggcaatgccgtggtattcgtcgacaaccacgacaaccagcgaggc
cacggcgcaggcggtgcgtccatcgtcaccttctgggacccgaggctctacaagatggcg
atgggctacatgctggcccacccttacggcgtaaccagggtcatgtcgagcttccgctgg
aaccggcacatcgtcaatggaaaggatcagaacgattggatgggaccgccgagtcatagc
gacgggagcaccaagtctgttcccatcaaccctgatcaaacctgcggggatggttgggtg
tgtgagcacagatggcgacagatcaagaacatggtcatcttccgcaacgtcgtcaacgga
cagcctcataccaactggtgggacaaccatggtaaccaggttgcctttggccgcgggaat
cggggtttcatcgtctttaacaacgacaactgggacctggacgtgactctgaacaccggc
atgcccggcggcacctactgcgacgtcatctctggccaaaaggagggagacatgtgcaca
ggaaagcagatccacgttggtgacgatggccgcgcccaattccggatcagtacccaagac
gaggacccctttgtggccattcacgccgaatccaaactgtaa

DBGET integrated database retrieval system