KEGG   Hippocampus comes (tiger tail seahorse): 109515983Help
Entry
109515983         CDS       T04969                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109515983 (ace)
Peptidases [BR:hcq01002]
 Metallo Peptidases
  Family M2
   109515983 (ace)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109515983 (ace)
CD molecules [BR:hcq04090]
 Proteins
  109515983 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1282 aa AA seqDB search
MDKFVWSVALVLQAVQHCDALPASWLPGEYSNTAADAVRFLGDYNSTAEEVFFYSVSASW
NYNTNLTEYNSQLQVNASLEEQAFIEAWGLKAKKVFTRELLDTLDPKDQKLMSNVMILGA
ANLPPEERGEYNTILSTMDSIYSTAKVHPQPNVSWSLEPHLTDIMATSRSYKKLLYAWEG
WHNTSGVPLKAYYPKFVQLSKKASQADGFKDTGAYWRSWYETDNFQEVIEQLYKTIEPLY
QHLHAFVRRQLYKQYGPKYINLRGPIPAHLLGNMWAQTWNNIYGLMIPFPDKPNMDVTEE
MLNQGYNATAMFRVAEEFFTSLGLAEMPPEFWQESMLEKPDDREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVGFRGGANPGFHEAIGDVLSLSVSTPK
HLKTIGLLKSATSDPESDINYLLKMALEKIAFLPFGYLIDQWRWGVFGGNIPPERYNAEW
WYLRTKYQGISPPTKRTEEHFDAGAKFHIPGNTPYIRYFVSFILQFQFHEKLCQAAKHTG
PLHTCDIYRSAEAGTILKKVLQAGSSKPWPEVLQEAIGTNKMDAGALMRYFQPIITWLEK
QNVNEVLGWPDFNWVPPIPEGYPEDIDKNTDELAAKNLLDEYNSTAEVVWNAYTEASWAY
NTDINEANKQNMLQKNLDMSAHTLKYGQRARQFDTADFQEDAVKRIIKKLSDIERAALPS
AQLEEYNNLLSNMETKYSVAEVCRDNGQCHPLDPDLQKIMAESRDYDELLFAWKGWRDAA
GKVLRSDYERYVELANQAARLNGHSDNGAFWRSLYETPTFEEDLERLWKELEPLYLNVHS
YVRRGLYNKYGPKRVNPRGPIPAHLLGNMWAQTWSGIMDLVMPYPHATQVDATPAMVAKG
WNAKRMFQESDNFFTSLGLLPMPKEFWDKSMLEKPTDGRQVVCHASAWDFYNRKDFRIKQ
CTVVTMDDLITVHHEMGHVQYFLQYKDQPVAFREGANPGFHEAIGDVLALSVSTPKHLKS
IGLLDKVENNHESDINFLMNMALDKIAFLPFGYLMDQWRWKVFDGRIPPSEYNKEWWNLR
MKYQGLCPPVPRNEDDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCNAAKHVGPLHT
CDIYKSKEAGKLLGDVMKLGFSKPWPEAMTMITGEPTMSAKPLMEYFEPLIKWLERENDK
NGDIRGWPDYDWKPLTGDPGVETSTVDFLGMNVDSAAAIAGQWVLLVLGLVLLVATIFLA
YRYRKSKRSNMSLSTIELKQKD
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atggacaagtttgtttggtcagtggcgctggtgctgcaagcggtgcagcactgtgacgct
ctgccggccagctggctgccaggagagtattccaacacggcggccgatgcagtgcggttc
ctcggcgattacaacagcacagcggaggaggttttcttctacagcgtgtcggccagctgg
aactacaacaccaacttgacagagtacaactctcaactgcaggtaaacgcatccttggag
gagcaagctttcatcgaggcctgggggctgaaggccaagaaggtgttcacccgtgagctg
cttgacacccttgaccccaaagatcagaaactgatgagcaacgtcatgatcctcggagcc
gccaacctgcctccggaagaaagaggagagtacaacaccattctcagcaccatggacagt
atttattcaaccgctaaagtgcatccgcagcccaacgtcagctggagcctggaacctcat
ctcaccgacatcatggccacctcccgcagctacaagaagctgctgtatgcttgggaaggt
tggcacaacacgtcgggcgtccccctcaaggcgtactacccgaaatttgtgcagctcagc
aagaaagcctcacaagccgacggatttaaagacacgggggcctactggcgctcttggtac
gagacggacaacttccaggaagtcatcgagcagctgtacaaaacaatcgaaccgctctac
cagcacctgcacgcctttgtgcgccggcaactctacaagcagtacggccccaagtacatc
aacctgcgaggacccatccccgctcatctgctgggaaacatgtgggcccagacctggaac
aacatctacggcttgatgataccgtttcctgacaaacccaacatggacgtgactgaagaa
atgctcaaccaaggctacaacgcgacggccatgtttcgcgttgcggaggagttcttcaca
tctctgggtttagccgagatgcctccagaattctggcaggaatccatgctggagaagccc
gacgatcgagaggtggtgtgtcacgcgtccgcctgggacttttacaaccgcaaagacttc
agaatcaagcagtgcaccacagtcacgatggaacagctcttcaccgtccaccatgagatg
ggccacgtgcagtattacctccagtacaaggaccaacccgtgggcttccgcggcggggcc
aaccccgggtttcacgaagccatcggcgacgtcctgtctctgtccgtctccacccccaaa
cacctgaagaccatcggactgctgaagtcggcgacgtccgaccctgaatccgacatcaac
tacctgttaaagatggcactggagaagatagccttccttccttttggctacctgatcgac
caatggagatggggcgtatttgggggcaacatccccccggagcgatacaacgcagaatgg
tggtacctcaggacaaaatatcaaggcatcagcccacccaccaagcgcaccgaagagcac
tttgacgccggcgctaaattccacattcctggaaacacaccgtacatcaggtattttgtg
agcttcatcctgcagtttcagttccacgaaaaactatgccaagcggccaaacacactgga
cccttgcacacatgcgacatctaccgctctgcagaagcggggaccattttaaaaaaagtt
cttcaggcgggttcctccaaaccttggcctgaagtgcttcaagaggccatcgggacgaac
aagatggacgcaggcgcactgatgagatactttcagcccattatcacgtggctggaaaaa
caaaatgtcaacgaagtcctgggatggcctgacttcaactgggtgccgcccattccggag
ggctatccggaggacattgataagaatacagacgagctggctgccaagaatcttctggat
gaatacaatagtacagcggaagtggtgtggaatgcctatacggaagcctcctgggcgtac
aacactgacattaatgaagccaacaagcagaacatgctccagaagaacctggacatgtca
gcccacacgttaaaatatggccaacgggcacggcagttcgacacggcggacttccaggaa
gacgcagtcaaacgcatcatcaaaaaactcagcgacatcgagagggccgcgctgccgtcg
gcgcagcttgaggagtacaacaatctcctgtccaacatggagaccaaatatagcgtagca
gaagtgtgcagagataatggccaatgccacccactggatcccgaccttcagaagatcatg
gcggagtccagagattatgatgagctgttatttgcctggaagggctggcgagatgcagcc
ggcaaagtacttcgctcggattacgagcgatatgtggaactggccaaccaagctgccaga
ctcaacggtcacagcgacaacggtgctttctggcgctcgctgtacgaaacgccgaccttt
gaggaggacctggagagactctggaaagaacttgagccgctctacctgaacgtgcactcc
tatgttcgcaggggtctgtacaacaagtacggccctaaacgcgtcaacccgagggggccc
atacctgctcacttgctcggtaacatgtgggcgcagacgtggtctggcatcatggacctg
gtcatgccttatccgcatgccacgcaagtcgatgctacgccagcgatggtggcaaagggc
tggaatgccaaaagaatgttccaggaatcagataactttttcacctctctggggctgctg
ccaatgccgaaagagttctgggacaaatccatgctggagaagcccaccgacggacgccaa
gtggtctgccacgcttccgcatgggacttctacaacagaaaagacttcagaatcaaacag
tgcaccgttgtgaccatggacgacttgatcaccgtccaccacgaaatgggccacgtccag
tacttcctgcaatataaggatcagcccgtggcgttccgcgagggcgccaaccctggcttc
cacgaggccatcggcgatgtcctggctttgtccgtgtccacacccaagcacctgaagagc
atcggcctcctggacaaagtggaaaacaatcacgagagtgacatcaactttctgatgaac
atggcgctcgataaaatcgccttcctgccgtttggctacctgatggaccagtggagatgg
aaggtgtttgatggacgcatcccgccgtccgagtacaataaagagtggtggaacctcaga
atgaagtaccaaggcctgtgtccacccgtcccccgcaacgaggatgacttcgacccaggt
gcaaagttccacatcccggctaacgttccctacgtgaggtactttgtcagcttcattatc
cagtttcagttccacaaggccctgtgtaacgctgccaagcacgtggggcccctgcacacg
tgcgacatttacaaatcgaaggaggctgggaagctgctaggagacgtgatgaagctgggt
ttcagcaagccctggcccgaggccatgaccatgatcacaggcgagcccacgatgagcgcc
aagccgctcatggagtatttcgaacctctcattaaatggctggagcgagagaacgataag
aacggggacatccgcgggtggcctgattacgactggaagcctttgacgggtgaccccggg
gtggagaccagcacggtggacttcctgggaatgaacgtggacagtgcggccgccattgcg
ggccagtgggtcctgctggtgctgggcctggtcctgttggttgccaccatcttcctggcg
tacagatacaggaagtcaaagaggtccaacatgtcgttatcaacgatagagctcaagcaa
aaagactaa

DBGET integrated database retrieval system