KEGG   Hippocampus comes (tiger tail seahorse): 109517114Help
Entry
109517114         CDS       T04969                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X1
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    109517114
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109517114
Chromosome [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109517114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MSPFPPCLDGVSAVDVSAAALPAPVPPTATTILPMDLRMVDHHHHHQQTPYGLVPQPHPA
PPTSTACPTSNEPSNGPCISHQEQQLQQELVALKHKQQLQRQLLIAEFQRQHEQLSRQHE
AQLHDHIQHQQDLMTLKHQQELLEHQRKVEQQRNEQQLEKQHREHKLLQLKNKERGQESA
VASTEVKMRLQEFVLNKKKALAQRNLNHCLSNDPRYWYGKTQHSSLDQSSPPQAMMSAYH
HAVLGTYDSKDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRKDGGPVTTAKKRSLD
IADSACSSAPGSGPSSPNNSSSNIPHENGAPISSSPGETSLLQRLVSRDGSVSHLSLYTS
PSLPNITLGLPATCPGSTAISGHQDAESRLALPAALQKGMPLTPPFLPAAHLPAYLASSG
LEREGVASGAAGHAPLLQHMVLLEQSHGPMVGLSGLALPSPSMSKLARGHHPLGRTQSAP
LPQQQCAQAQALQQLVVQQQHQQFLEKHKQQFQHQQHIINKMMSKPSEQSSAASSAAPVS
SRQHQSHPEETEEELREHQGLLSSASSSSVAIKQEPLDLQEQEERQAEQELLFQQQQALL
LEQQRIQQLRSYRASMEAAGLSVSLAGHRPLSRAQSSPASPSFPMTVQEPAVKPRFTTGL
VYDSLMQKHQCMCGNTNSHPEHAGRIQSIWSRLQETGLRGHCECIRGRKATLEELQTVHS
EDHVLLYGTNPLRQKLDCSASPMFVRLPCGGVGVDSDTIWNEIHSSSAARLAVGSVVELV
FKVASGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVH
HGNGTQQAFYSDPNVLYLSLHRYDDGNFFPGSGAPDEVGSGPGTGFNVNMAFTGGLEPPM
GDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDPVDGHAPPLGGYTLTGKCFGYLTRQLMA
LAGGRLVLALEGGHDLTAICDASEACVSALLGNELEPIPDEVLHQRPNANAVHSMEKVLE
AHSRYWRSLQRSASTLGCSLSEVLRGDADEAETVSAMASLSVANKHFGRKADEEPMEEDA
SM
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccttccccccgtgcttggatggcgtttctgcagttgacgtgagcgcagcagcc
ctgcccgcgccggtgccccccacggccacaacgatcctccctatggacctgcggatggtt
gaccaccaccaccaccaccaacagaccccctacggtttagtcccccagccacaccctgcg
ccgcccacctccaccgcttgccccacatcaaatgagccgagcaatgggccgtgcattagc
caccaagagcagcagctgcagcaggagctggtggctctcaaacacaaacagcagctccag
aggcagttactcattgctgagtttcagaggcagcatgaacagctgtccagacaacacgaa
gcccagcttcatgatcacatccagcaccaacaggatttgatgacgttgaaacatcagcag
gagctgctggagcatcagaggaaggtggagcagcagcgcaacgagcagcagttggagaag
cagcaccgggaacacaagctactgcagctcaaaaacaaggagcgcggccaagaaagcgcg
gtggccagcaccgaggtcaagatgcgacttcaagagtttgtcctgaacaagaagaaagcc
ttggctcagcgaaacttaaaccactgtctgtccaacgatccccgctactggtacgggaaa
acacaacacagttcactggatcaaagctcccctcctcaagcgatgatgtcagcataccac
cacgcagtgctgggcacgtacgactcaaaagacgacttcccactccgcaaaacagcctcc
gaacccaacctgaagcttcgctcgcgactaaagcagaaggtgacggagcgccgcagcagc
cctctcctccgcaggaaagacggcggccccgtcactacggccaagaaacgctccctggat
attgccgactctgcatgtagcagtgcccccggctcaggtcccagctcccccaacaacagc
tccagtaatatcccccacgagaacggggctccaatctccagcagcccaggagagacgtcc
ctgctccagcgcctggtttcaagggacggttccgtcagccatctctcactttacacctcc
ccttctctgcccaacattacgctggggctgccggctacatgtcccggaagcaccgcaata
tcaggacatcaagatgccgagagccgccttgcgttgcctgccgccttgcagaagggcatg
cctttgactccccctttcctgcccgctgcccacttgcccgcctacttggcatcttcaggt
ctggagcgagagggcgtggccagcggcgcagctggccacgccccccttctgcaacacatg
gtgctgttggagcagagccacggtccaatggttggtttaagcggccttgcgctcccgtcg
ccttcaatgtccaagctggcacgcggccatcaccctctgggtcgaacccagtcggcgccc
ctgccgcagcagcagtgcgctcaggcgcaggccctgcagcagctggtggtccagcaacag
caccagcaattcctggagaagcacaagcaacagttccagcatcagcagcacatcatcaac
aagatgatgtctaaaccgagcgagcagagctcagccgccagctcggcggcgcccgtgtcg
tccaggcagcaccagagtcacccggaggagacagaagaggaactgagggagcatcagggg
ctcttgtcctcggcctcctcgtcctcggtggccatcaagcaggagcccctcgaccttcag
gagcaggaggagaggcaggctgagcaggagctcctcttccagcagcagcaggccctactg
ttggagcagcaacgtatccagcagttgaggagctaccgggcgtcgatggaggcggccggc
ctgtcggtcagcctggcgggccaccgccctctctccagggcgcagtcctctccggcctca
ccctccttccccatgacggtgcaggagccggcggtcaagccacgtttcacaacaggtctg
gtgtacgactccttgatgcagaagcaccagtgcatgtgcggcaacaccaacagccacccg
gagcacgcgggtcgcatccagagcatctggtcgcgtcttcaggaaacgggcctcaggggc
cactgcgagtgcatccggggaaggaaagccacactggaagaactccagacggtgcactct
gaagaccacgttctgctgtatggaaccaacccactacggcagaagctggactgttccgcc
agtcccatgtttgtgagattaccatgcggaggcgtcggggtggacagcgacaccatttgg
aacgagatccattcgtccagcgcagctcgactggctgtcggctcggtggtggagctcgtc
tttaaagtagcgtcaggagaactgaagaacggttttgcagtcgtgcgaccacctggacac
cacgcggaggagagcacgcctatgggattctgttacttcaactcggtggccgtcgccgcc
aagctcctgcagcagaggctcaatgtcagcaagatcctcattgtggactgggatgttcac
catggcaacgggacccagcaggctttctacagcgaccccaacgttctttacctgtcctta
catcgctacgacgacggcaactttttcccaggaagcggagcccccgatgaggttggcagc
ggccctggtaccggcttcaacgtcaatatggccttcactggaggactcgaaccacccatg
ggcgatgccgagtacttggcagcattccggacagtggtgatgcccatagccaatgagttt
gccccggacgtggttctggtatcatctggttttgacccggtggacggacacgcgccgcct
ttgggtggctacacgctgactggcaaatgtttcggctacctgaccaggcagctgatggct
ctggcaggcggtcggctggtactcgccctggagggaggccatgacctcacggccatatgc
gacgcgtctgaggcctgcgtctccgctctgctcggcaacgagttggagcccattccagac
gaggtcttgcatcagagaccaaacgccaatgccgtccactcgatggagaaagttcttgaa
gctcacagtcgatactggcgctcgctgcaacgctcggcctccacgctcggatgctctttg
agcgaagtcctacggggggacgccgacgaggcggaaaccgtctccgcgatggcctcgctg
tccgtcgccaacaagcactttggaaggaaggctgacgaagaaccgatggaagaggacgcc
tccatgtaa

DBGET integrated database retrieval system