KEGG   Hippocampus comes (tiger tail seahorse): 109519080Help
Entry
109519080         CDS       T04969                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00590  Arachidonic acid metabolism
hcq01100  Metabolic pathways
hcq04370  VEGF signaling pathway
hcq04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    109519080 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    109519080 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    109519080 (ptgs2)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109519080 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109519080
NCBI-ProteinID: XP_019730958
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNKSTLTLLLLFLGCLVCEGGNLCCSEPCQNRGVCTALGSDAYECDCTRTGYYGPNCTTP
EFLTRIKVLLKPTPNTVHYLLTHFKGFWNIINNISFLRNAIMKYVLTSRSHMIDSPPTYN
ADYHYKSWEAYSNLSYYTRALPPVQQDCPTPMGVVGKKELPDVKLLAEKLLMRRKFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKRGPAFTVAKGHGVDLSHVYGDSLEKQHKLRLFKDGK
LRYQMLDGEMYPPTVKDVGVDMHYPPHVPHSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCNVLKQVHPYWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFSQRF
QYQNRIASEFNTLYHWHPLMPDSFHIEEKNYNYKEFVFNTSVVTEHGIASLVESFSKQIA
GRVAGGRNVPGPIMYVAIKSIEASRQMRYQPLNAYRKRFSMAPYKSFEDLTGEKEMAAVL
EEMYGDIDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSVGFDIVNTASLQKLVCNNVQGPCPVASFHVPDIDDTGSTVINSSTSPSRSGDMNPTVI
LKKRTSEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtccactttaacgcttctcctcttgtttcttggttgtcttgtttgtgaggga
ggtaacctttgctgctcagagccatgccagaacagaggtgtttgcacagccctcggatct
gacgcttatgaatgtgactgcacgcgtactggctattacggcccaaactgcacaacacct
gaatttctcacccggataaaagtgctcttgaagcccacacccaacacagtccactatctt
ctcacccacttcaagggcttctggaacatcatcaacaacatctcgtttctcagaaatgcc
atcatgaaatatgtgctaacatctcgctcccacatgattgacagccccccaacctacaat
gcagattatcattacaaaagctgggaagcatattccaacctttcctactacacgagagcc
ctccctccagtgcaacaggattgcccaacaccgatgggagtcgtaggtaaaaaggagctt
cctgatgtgaagctgcttgcagagaagctactgatgaggaggaaattcatccctgaccca
cagggcaccagccttatgtttgcattttttgcacagcactttacacaccagttctttaaa
tcggacatgaaaagaggtcctgccttcacagtggcaaaagggcatggggtggacctcagt
cacgtttatggagacagcctggagaagcaacacaaactgaggctcttcaaagacggcaaa
cttagatatcagatgctggatggggagatgtaccctccgacagtaaaagatgtaggcgtt
gatatgcactacccccctcacgtccctcactctcatcgctttgctgtgggccatgaggct
tttggcctggtccctggtctcatgatgtatgccaccatttggctccgggaacacaatcga
gtgtgcaatgtcttgaagcaagtccatccttattgggatgacgaaagactctttcagact
tcgcgactcattctgattggggaaaccatcaagattgtgattgaggactacgtccagcac
ctgagtggctataacttcaagctaaaatttgatcctgagctgctcttcagccagcgtttc
cagtaccagaaccgcattgcatctgagttcaacaccttataccactggcacccactgatg
cccgactccttccacatcgaggagaaaaactacaactacaaagagtttgtcttcaacacc
tctgtagtgactgagcacggcattgccagcctggtggagtccttcagcaagcagatagct
gggcgggttgctggtggtcggaatgtcccaggaccgattatgtatgtggctattaagtcc
atagaggccagcagacaaatgcgttaccagcctttgaacgcctacaggaaaaggttctct
atggctccgtacaagtcttttgaagatttgacaggtgaaaaagaaatggcagcagtgctt
gaagagatgtatggagatattgatgccgtagagctctacccaggcctacttgtggaaaaa
cccagacccaatgccatctttggggagaccatggtggagatgggagcccctttctcactc
aaaggcttgatgggaaaccccatctgctctccagaatactggaagcccagcacgtttgga
ggcagtgtaggatttgacattgtcaatacagcatctctgcagaagcttgtgtgcaataat
gtgcaggggccttgtccagtggcatcatttcacgtgcctgacatcgatgatacaggctcc
accgtcatcaactccagcacatccccctcacgcagtggtgacatgaacccgacagtcatt
ttgaaaaaaaggactagtgagctctaa

DBGET integrated database retrieval system