KEGG   Hippocampus comes (tiger tail seahorse): 109519328Help
Entry
109519328         CDS       T04969                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04210  Apoptosis
hcq04625  C-type lectin receptor signaling pathway
hcq04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    109519328
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    109519328
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    109519328
   04672 Intestinal immune network for IgA production
    109519328
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109519328
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: STE group
  Other
   109519328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 109519328
NCBI-ProteinID: XP_019731337
LinkDB All DBs
Position
Unknown
AA seq 879 aa AA seqDB search
MAVSQRILNSTSPFSGSPLADLKASYPKCKAGEKGTQQHHKQQQQQQGEEEEDEEQWKSS
KVDYIARLSPLLNKVLTQGTAEQVGETSLKSSPFIAQAECETQDSQEFSPSCFERSYVPS
SGCFIVSLQPEHNNVACPTTASVQAPTPLGPRKKPRKRVKRKGRKKVPLGKNKKEEERQP
SRYHTDTAVPSGVPEQESGSSLEHIQEDSLHAGRSRLSSSCCSSVESAEDVVPPLYGTKL
YNTGSGCSPLAWAEPFPGTLCSLCSYGPDSDSLSSAGDCSLALAGLRGSVSQGDACYAGP
FFKEVERNAGEEEEDKWQSVDNEGIIFYNENIQPVESEYKEGREFVLSEFIKEGSYGEVH
SAQDVNTGFKFAVKKIPLKRFNSEEASTWSALRSPRILELFGVVRDGPYVFFLMDHKSGS
LSQMIIRRGRLPEDLSLYYLLQVATALEYLAKKKVVHLDVKADNVLLSEDGRDSFLCDFG
HAERLDSGGQSLSGSRDLKGTETHMAPEMVMGEPRGARADVWSSCCMLLHMLNGCPPWTR
YYTCRLFLKIANDPPPLREIPPDCGPLTAELIKAGLQKDPSKRASASDMKERAARALKQV
GGLRSPWRSSYTEPLYFANKPPDSPPVECENDENNTDRSSIVRLTPDSPPVECENDEEEN
TDRSSIVQLNNGDEDEADVCEQGTNFDLKQSKNRITNTVPELELRKLEKDFYLSSLSQLH
SAEMQEQLLSCLSSDAYSNRDPWDKKDSGRWSLSPADDYSSGVCSDSSQLDGHQSVSLDL
LGHSPPQPCCFQGVDVCIRDFNGTIIQIRETRRVKVGHIATGISDQISERVFTLETQLGC
TVAHDEEVQESGLKLCCVPAPDFSASWRWRIRDGALETR
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgagccagaggatcttaaactccacctccccgttctcggggtcgccgctggcc
gaccttaaggcctcgtaccccaaatgcaaagctggggagaaaggaacccagcagcaccac
aaacagcaacagcagcagcaaggggaagaagaggaggacgaagagcagtggaagagcagc
aaagtggactacatcgctcgtttgagtcccctgttgaacaaagtgctgactcagggcact
gccgagcaagtcggagagacatcgctgaagagctcccctttcattgcacaggccgaatgt
gaaactcaggactcacaggaatttagtccgtcctgttttgagcgttcctacgtcccctca
tctggctgttttatcgtcagtctgcagccggagcacaacaatgtggcttgcccgaccacg
gcctccgtccaagcgccaacgccactcggccccagaaagaagccccgaaaaagagtgaag
cgcaaaggccggaaaaaagttcctttggggaagaacaagaaagaagaggagcggcaaccg
agcagataccacacagatactgcggtgccctctggagtgcctgaacaggagagtgggagt
tccctggagcacatccaagaggactcgctgcacgcaggaaggagccgcctcagttcctcg
tgctgcagcagcgtggagagcgcagaggatgtcgtgcctcctctctatggcactaagctc
tacaacacaggctccggctgctccccgctggcttgggccgagccattcccgggcactcta
tgtagcctctgctcctacggaccagacagcgactcgctcagcagcgccggcgactgctcg
ctggccctcgccggcctgcgaggcagcgtcagccagggcgacgcgtgctacgcggggccc
ttctttaaagaggtggagcgaaacgccggagaggaggaagaagacaagtggcagtccgtc
gacaatgaggggatcattttttacaacgaaaacatccagcctgttgaatcagagtataag
gaaggaagggagtttgtcctgtcagagttcatcaaggaaggctcctacggcgaagtccac
agcgctcaagatgtcaacaccgggttcaagtttgctgtcaaaaagatccccctgaagagg
ttcaacagcgaggaggcgagcacgtggagtgccctccgatctcctcgcatcctggagctc
ttcggagttgtccgagacgggccttatgttttctttctcatggaccacaaatctggctcg
ctcagccaaatgattatacgccgtgggcggctgccggaggacctgagcctctactacctg
ttgcaagtcgcgacagcccttgagtacctggccaagaagaaagtggtgcatcttgatgtg
aaagccgacaacgtgttgctgtctgaggacggcagagactccttcctgtgcgactttggc
cacgccgagagattggacagtggcgggcagagtctcagtgggtctcgagacctgaaaggt
actgagacgcacatggcccccgaaatggtgatgggcgaaccccgcggagccagagcagat
gtgtggagcagctgctgcatgttactgcacatgctcaatgggtgcccaccttggaccaga
tattacacctgtcggctcttccttaagatcgccaacgacccgccgccgctccgagagatc
ccgccggactgcggccctctcacggcggagttgatcaaggcgggactgcagaaggatccc
agcaagagagcgtcggccagtgacatgaaggaacgtgcggccagagcgctcaaacaagtt
ggcggactcagaagcccatggaggagttcctacacggaacctctttatttcgccaacaaa
cccccagactccccaccagtcgagtgtgaaaacgatgagaacaacacggacaggagttcg
atagtgcggctgacgccagactccccaccagtcgagtgtgaaaacgatgaggaggagaac
acggacaggagttcgatagtgcagctgaacaacggcgatgaagacgaagccgacgtgtgt
gagcaaggaactaatttcgatttaaaacagtcgaaaaacaggatcaccaacactgttcca
gaacttgagctgcgtaaactagagaaagacttctatctcagtagcctttctcagcttcac
tctgctgagatgcaggagcagctcttgtcttgtctcagcagcgacgcctactccaaccgg
gatccgtgggacaaaaaggactcgggccgctggtcgctgagccccgccgacgactatagt
tcaggagtctgctctgacagcagccagctggacgggcaccagagcgttagtttggacttg
ttgggccactcgccgcctcaaccgtgctgcttccaaggggtggacgtctgcatccgagac
ttcaacgggacaatcatccaaatccgagagacgcggcgggtgaaggtgggccacatcgcc
accggcatcagcgatcaaatctccgagagagttttcaccttggagacacagctgggctgc
acagtggctcacgacgaggaggttcaggagtcggggctgaagctctgctgcgtcccggct
cctgatttcagtgcctcttggaggtggaggatcagagatggcgcactggaaactagatga

DBGET integrated database retrieval system