KEGG   Hippocampus comes (tiger tail seahorse): 109520621Help
Entry
109520621         CDS       T04969                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    109520621
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109520621
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109520621
   00430 Taurine and hypotaurine metabolism
    109520621
Enzymes [BR:hcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109520621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 582 aa AA seqDB search
MATSEPRTTSGEQDPNTANLRPSSTTYEYAWMHGCTRKLGMRICGFLQKNNSLEEKGRLS
QKNLLSCDNSDRDARFRRTETDFSNLFARDLLPAKNGEEPTMQFLLEVVDILTNYVKKTF
DRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQLS
SGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPGGEGDGLFSPGG
AISNMYSVMIARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTENVILLS
TDERGRVIPADLEAKIIDAKQKGYVPLFVNATGGSTVYGAFDPINEIADICEKYNLWLHV
DGAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVPLQCSAILVREKGLMGGCNSMCA
GYLFQQDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTTGFEQHIDRCLDLSQYLYN
KIKNREGYEMVFDGVPQHTNVCFWYIPPSLRGMPDSEERREKLHRVAPKIKAMMMESGTT
MVGYQPQGNKVNFFRMVVSNHAATQSDIDFLIDEIERLGRDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtcagagccgagaaccaccagcggggaacaggaccccaacaccgccaattta
agaccctcatccacaacctacgaatatgcgtggatgcatggctgtacaaggaaactgggc
atgaggatttgtgggttcctgcagaaaaacaacagcttggaggagaagggcagactgagt
cagaagaacctgctctcctgcgacaacagtgacagggacgctcggttccgacgcaccgag
accgacttctcaaacctgtttgcccgagacctgttgcctgcaaagaatggcgaggaacca
accatgcagtttttactggaggtggttgacatactgaccaactacgtgaagaagacattc
gaccgctccaccaaggtgctggacttccaccaccctcaccagctcctggagggcatggag
ggcttcaacctggaactgtccgaccagcccgagtctctggagcagatcctggtggactgc
agggacacgctcaaatatggtgtgcggacaggtcaccctcgtttcttcaaccagttgtcc
tcgggtttagacatcatcggtctggcaggggagtggctcacctcgactgccaacaccaac
atgtttacttacgagatcgctccggtgtttgttttaatggagcagctgaccctgaagaag
atgagagagatgattggctggcccggtggcgagggagacggccttttctcgccagggggc
gctatttctaacatgtacagtgtgatgatcgctcgttacaagtatttccccgaggtcaag
accaagggcatgtctgctgctcctcgtctggttctgttcacatcggaacatagccactac
tccatcaagaaagccggtgctgctctgggatttggcaccgagaatgtgattctgctgagc
acggatgagagggggagggtcattcctgcggatctggaggctaagatcattgacgccaaa
caaaagggttacgtgccattatttgtgaacgccaccggtggctccaccgtctacggtgcc
tttgaccccatcaatgagattgcggacatttgcgagaagtacaacctgtggctgcacgtt
gacggagcgtggggtggcggcctgctgatgtccaggaagcaccgccataaactcaacggg
attgagagagccaactctgtcacgtggaaccctcacaagatgatgggcgtgccgctccag
tgctccgccatcctcgttagggagaagggactgatgggcgggtgcaactccatgtgcgcc
ggttatttgttccaacaagacaagcagtacgacgtcacgtacgacactggggacaaagcc
atccaatgtggccggcatgtggacatatttaagttctggctcatgtggaaggcgaagggc
accactgggtttgagcagcacattgacaggtgcttggatttgtctcagtacctgtacaac
aagatcaagaacagggaggggtatgagatggtgtttgatggcgtgcctcagcacaccaac
gtttgcttctggtacatcccacccagcctgaggggaatgccagacagtgaggagaggcgg
gagaagctccacagagttgcaccaaagatcaaggccatgatgatggagtcaggtaccacc
atggtgggctaccagcctcagggcaataaagtcaacttcttccgtatggtcgtctccaac
catgcggccacccaatctgacatcgacttcctcattgatgagatagagaggctgggtcgt
gacctgtag

DBGET integrated database retrieval system