KEGG   Hippocampus comes (tiger tail seahorse): 109528227Help
Entry
109528227         CDS       T04969                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109528227 (suv39h1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109528227 (suv39h1)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109528227 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109528227 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 109528227
NCBI-ProteinID: XP_019746147
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MAEISNDCSVPSKMSWDDLEAVCRREGLKCKALGITRANVNEYEVEFLCDYKKTKEEEFY
LVKWRGFSESVNSWEPKRHLKCPILMKQFHLDLDQELQRQKRHSIPKKLDKEISTFLVQK
AKLRQRLKSWETLLNQTCSHPGRIFVMNDVDLEGPPKNFTYINNYKAGPGIVFNEMAVGC
ECKNCFEEPVNGCCPGASLHRIAYNEHGQVRIRPGKPIYECNSQCLCSSDCPNRVVQKGI
QFDLGIFKTDNGRGWGVRTLQHIKKNTFVMEYVGEIITTDEAEKRGHIYDREGSTYLFDL
DYVEDVYTVDAAHQGNVSHFVNHSCNPNLQVFNVFIDNLDERLPRIALFSTRAIRAGEEL
TFDYKMQINPVDTESSKMDSSFTLAGVPSSPKKRIRVECRCGSDSCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatttcgaacgattgcagtgtccccagcaagatgtcgtgggatgaccttgaa
gccgtgtgtcgccgagaggggcttaaatgtaaagcattgggaataacaagggccaatgtc
aatgagtatgaagtggagtttctctgtgactacaaaaagacaaaggaagaagaattttac
ctggtcaaatggcgcggcttttcagagtcagtcaacagctgggagcccaagaggcatctc
aaatgccccatactgatgaagcagttccacttggacctggatcaggagttgcagcgccag
aaaagacattccatccccaaaaagctagataaggaaatttcaacattcctagttcaaaaa
gctaaactccgtcagagactgaagagctgggagactctgttgaaccaaacctgcagccac
cccggccgcatctttgtcatgaacgatgtcgaccttgaaggtccaccaaagaacttcaca
tacatcaacaactacaaagcaggccctggcattgtttttaatgaaatggctgtgggctgt
gagtgcaagaactgtttcgaggagccagtgaacggatgctgtcctggcgcatcattgcat
cggattgcttacaatgaacatggccaagtccggatcagaccaggaaaaccaatatatgag
tgtaattcccagtgcctctgtagctcagactgcccaaacagagtagtccaaaaaggcatt
cagtttgacctaggtatctttaagacggacaacggtcggggatggggagttcgcacgctg
cagcatataaagaagaacacatttgtcatggagtatgtgggagagatcatcacgacagat
gaagcagagaaacgaggtcacatatacgaccgcgaaggctctacgtacctttttgatctg
gactatgtggaggatgtatacacagtggatgctgctcaccaaggcaacgtctctcacttt
gtcaaccacagttgtaacccaaacctgcaggtattcaatgtgtttattgacaaccttgat
gagaggctcccaagaattgctttattttcaacacgagccattcgtgcaggagaggaactc
acttttgactacaaaatgcaaattaatccagttgacacagaaagctccaagatggattcc
agtttcaccttagcgggtgtccccagttcgccaaagaagaggattcgagtggagtgccgg
tgtggctccgactcgtgcagaaaatacctgttctaa

DBGET integrated database retrieval system