KEGG   Hippocampus comes (tiger tail seahorse): 109528296Help
Entry
109528296         CDS       T04969                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X1
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    109528296
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109528296
Chromosome [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109528296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MLRTIFEAECSLSPTEGILGKEQPLEVLKTSALNHIPTVDINSALPMRLPPAAIPMDLRM
DQQQQVSPLSPPRQQASGVVVSAPVREQQLQQELLSLKQKQQIQRQILIAEFQRQHEQLS
RQHEAQLQEHIKQQQELLAIKHQQELLEHQRKMENHRLEQELEKQQREQKLQLLKNKERG
QESAVASTEVKMRLQEFVLNKKKALAQRSLNQGGPPNDAPYWYRKTQHSSLDQSSPPQTV
MSTYNHPVLGVYNPRDDFPLRKTASEPNLKLRSRLKQKVSERRSSPLLRRRDSPITSAKK
RSLDMADSACSSAPGSGPSSPNNSSNNIPNENGITVSVSNSKEAPMSQRVCSGAERGSIS
QLSLYTSPSLPNITLGLPATATATAASNVTSAQQDGSLQPALSLSPPFLSGGHLTPYVAE
AAAGTGGHSPLLQHMVLMEQTPAQSPLVTGVSGLSMSPAASMAKLQRQHRPLGRTQSAPL
PQGSAAQAHAQALALQQLVVQQQHQQFLEKHKQQFQQQQQQQLQFNKLIAKPSESPVGRQ
HQSHPEETEEELREHQDVGVLPLGVTIKQEPPDPQELQEEALQQHRERERLAEQELLFRQ
QQALLLEQQRIHQLRNYQASMEAAGLSITFPGHRPLSRAQSSPASASPFSISVPQSDPPI
KPRFTTGLVYDSLMQKHQCMCGNTNSHPEHAGRIQSIWSRLQETGLKAHCECIRGRKATL
EELQTVHSEAHVMLYGTNPLRQKLDCSITPMFVRLPCGGVGVDSDTIWNEVHSSSAARLA
VGSVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNINRI
LIVDWDVHHGNGTQQAFYDDPNVLYLSIHRYDDGNFFPGSGAPEEVGSGPGVGFNVNVAF
TGGLDPPIGDVEYLAAFRSVVMPIANEFAPDIVLVSSGFDAVEGHPPPLGGYTLSSKCFG
FLTRQLMSLAGGRLVLALEGGHDLTAICDASEACVAALLGQELDPLSKAVLEDRPNPNAV
RSLEKVLETHCKYWRSVCRHSPQLGLSLLEAKRGDSEEAEAVSAMASLSVANTSALDHRP
EEEPMEEEEPL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggaccatatttgaagcggagtgttctctctctcccacagaggggatcctggga
aaggaacagccgctggaggttctcaagacgtcggcactcaaccacatcccaacagtggat
atcaattcagcactgccgatgcgcctcccgcctgccgccatccccatggacctgcgcatg
gaccagcagcaacaggtgtcccctctgtccccaccccgccagcaggccagcggggttgtc
gtctccgctcctgtacgcgaacaacagctgcaacaggagttgcttagcctgaagcagaag
cagcaaatccagagacagatcctaatcgccgagttccaaaggcagcatgagcagctttcc
cgtcagcacgaggcccagctccaggaacacataaagcaacaacaagagctgctggcaatc
aagcaccaacaggaactgttggagcaccagaggaaaatggaaaaccaccgtcttgagcaa
gagctggagaagcagcagcgtgaacagaagttgcagctgctaaagaacaaggaaaggggg
caggaaagtgctgtggcaagtacagaggtaaagatgcgtctccaggagtttgtccttaac
aaaaaaaaggccctggcccagcggagcctcaaccagggcggcccccccaacgatgctccc
tactggtacagaaaaactcagcacagttctctagaccagagctcacctccacagactgtt
atgtccacctataatcaccctgtgctgggcgtctacaatccacgggatgacttcccgctt
cgaaaaacagcctccgaacccaacttgaagctgcgctccaggctgaagcagaaggtcagc
gagcggaggagcagcccacttctccgtcgtcgagacagccccatcacctctgcaaaaaag
cgctctctcgacatggcagattctgcatgtagcagtgccccgggctcaggcccaagctcc
ccgaacaacagttccaacaacatccccaatgaaaacggcatcactgtgtcagtctccaac
agcaaagaggcacccatgagccagagggtgtgcagtggtgctgagcggggctctattagc
cagctatccctctacacatcaccatccttaccaaacattactttgggcttgcctgccact
gccaccgccactgctgcctccaatgtgacatctgctcagcaagatggcagtctgcagcca
gcgctctccctcagccctcctttcctctcaggtggccacttgacaccctatgtggctgaa
gcagcagcagggacaggggggcacagtcctctgcttcagcacatggtactcatggagcag
actcctgcacagagccccctggtgacaggtgtaagtggcttgtccatgtcgccggcagcc
tccatggccaagctgcagcgccagcatcgacctctgggccgcacccagtcggcgccgctg
cctcaagggagtgctgcccaagcgcatgcccaggcgcttgctttacaacagcttgtggtc
cagcagcagcaccaacagttcctggagaagcacaagcagcaattccagcagcagcagcag
cagcagcttcagttcaacaaattgatagccaagcccagcgagtcgcccgtgggccgccag
caccagagccacccggaggaaacggaggaggagctgagagagcaccaagatgttggcgtg
ctaccattaggggtcaccatcaagcaggagcctcccgacccgcaggagctccaggaggaa
gcgctgcagcaacaccgggagcgggagaggctagcggagcaggagcttctcttcagacag
cagcaggcactgttgttggagcagcaacgaattcaccagctaagaaactatcaggcttcc
atggaagctgccgggctgtccatcaccttcccaggacaccggcctctatcgcgggcccag
tcgtctccagcttcagcctcccccttctccatcagtgtcccacaatctgatccacccatt
aagcctcgcttcaccacaggtctggtgtatgattctctaatgcagaagcaccagtgcatg
tgtggcaacaccaacagtcacccagagcacgcgggccggatccaaagcatttggtcccgc
ttgcaggaaaccggactcaaggcgcattgcgagtgcatccgtgggagaaaggccacacta
gaggaactgcagacggttcactctgaggcccatgtcatgctgtatggaaccaaccctctc
agacagaaacttgattgttcaatcacgcccatgtttgtgcggctaccatgtggcggcgtg
ggcgtggacagtgacacgatctggaatgaagtccactcctccagcgcagctcgcctcgcc
gtcggctctgttgtcgagcttgtcttcaaagtggccactggggagctgaagaatggcttc
gccgtggtgcgacctccaggacaccatgcagaggaaagcacgcccatgggcttctgctac
ttcaactctgtggccattgctgccaaactgctccagcagagactcaacatcaacaggatc
ctcatcgtcgactgggatgttcaccacggcaacggcacccagcaggccttctacgatgac
cccaatgttctgtacctttctattcatcgctacgatgacggcaatttcttccccggtagt
ggcgcacccgaggaggtaggaagcggcccgggagtcggcttcaatgtcaatgtcgccttc
actggagggcttgacccacccattggagatgttgagtacctggctgccttcaggtccgtc
gtgatgcccatagccaatgagtttgctccagacatcgtgctcgtgtcctctggcttcgac
gcagtggaaggacaccctccaccacttggaggctacacactgtcatccaaatgtttcggc
tttctgacccgccaactgatgagccttgccggaggcaggttggtcctggctctggaaggg
ggtcatgatctgacggccatctgtgacgcctcagaggcctgcgtcgctgcactgctggga
caggagctggacccactatccaaggctgtcctcgaggacaggcccaaccccaatgctgtg
cgttctctggagaaggttctcgaaactcactgcaaatactggcgctcggtgtgtcgccat
tcgccacagctgggcctctcactattggaggccaaacgcggtgactcagaggaggctgag
gctgtcagtgccatggcctctctgtcggtggcaaacacaagtgctctggatcacagacca
gaggaggaacccatggaagaggaggaaccactgtaa

DBGET integrated database retrieval system