KEGG   Hippocampus comes (tiger tail seahorse): 109528392Help
Entry
109528392         CDS       T04969                                 

Definition
(RefSeq) putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC100288842
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    109528392
Enzymes [BR:hcq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     109528392
Glycosyltransferases [BR:hcq01003]
 Glycan extension
  Glycolipid
   109528392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MVVRGLWRCIPRLGKRGGRSGFLSCLCVAIVSVAVFALLFVDVIEYWITSLRMSAVREPH
ARIFPPQNVPPTRPEEFLLMPSPLVCQRANPYLITMVISAPAHHRARQAIRDTWGGESNV
SGLRVMTLFMLGVPSDPGLAKMLFEEAREQGDLVQGRFLDSYANLTLKTLALQSWVRRFC
PQAHFVAKVDDDVLFNPSALLHLLNKSRSPYEQSDLYLGKVHLRVAPKRDPRSKHYVPNE
AYPSSVFPDYCSGTAYVLSRSALLKISLAASVSPLSTAQPPEDVFVGVCARAAGILPTHS
SLFSGGPPMPYGRCCYQAMVSVHHIAPRDMLYYWADIHSSGQCLWLSTRASLCMCKVGAL
LGSVLGLGKEA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttcgggggctgtggagatgcataccaaggttgggaaaacgaggggggcgctct
ggcttcttgtcgtgcctgtgcgtggcgatcgttagcgttgccgtcttcgcgttgctcttt
gtggatgtcattgagtactggatcacgtctctgcggatgagcgccgtgcgggagccacat
gcccgcatattccccccacagaacgtccctcccaccagacccgaggagtttctgctcatg
cccagtccgctggtgtgccagcgtgccaatccgtacctcatcaccatggttatttcggcc
cctgctcaccacagggcacgtcaagccatcagggacacgtggggcggggagagcaacgtg
agtggcttgagggtcatgaccctcttcatgctgggtgttccatctgacccaggactggcc
aaaatgctctttgaggaggctagagagcaaggggacttagttcaaggacgtttcctggac
tcgtacgccaacctgaccctgaaaactttagccctccagagctgggtgcgccgcttctgc
ccccaggctcactttgtagccaaagtggatgacgacgtcctcttcaatcccagcgcactc
ctgcacctattgaacaagagccgcagcccgtacgaacaaagtgacttgtatctcggcaaa
gtgcatctccgcgtggctccgaaacgggaccctcgaagcaagcactatgtcccgaatgag
gcctacccgtcatctgtttttccagactattgcagtggtacagcatatgttctatcccgc
tccgcattgctcaaaatatcattggctgcctctgtgtcacccctatccacggctcaaccc
cccgaagatgtgtttgtgggggtgtgcgcccgggcagctggcatcctgcctacacactcc
tccctgttctctggtggaccacctatgccgtatggacgctgctgctaccaagccatggtg
tcggtacaccacattgcacctcgggatatgctgtactactgggctgatatccactcatcg
ggacagtgcctgtggttgagcacgcgagcatccttgtgcatgtgcaaagtcggtgccctg
ctgggctcagtgcttggcctggggaaggaggcgtga

DBGET integrated database retrieval system