KEGG   Hippocampus comes (tiger tail seahorse): 109531513Help
Entry
109531513         CDS       T04969                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109531513 (hk1)
   00051 Fructose and mannose metabolism
    109531513 (hk1)
   00052 Galactose metabolism
    109531513 (hk1)
   00500 Starch and sucrose metabolism
    109531513 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    109531513 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109531513 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109531513 (hk1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109531513 (hk1)
Membrane trafficking [BR:hcq04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109531513 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MIAAQLLAYYFAELKDDQVKKIDKYLYSMRFSDETLLDITQRFRMEMVKGLSRETYTTSS
LKMLPTFVRSIPDGSEKGDFIALDLGGSAFRILRVKVSHEKKQTVQMESQIYDTPEDIMH
GSGTRLFDHVAECLGDFMEKHNIKDKKLPVGFTFSFPCQQTKLDEPRFVCLQSTLITWTK
RFKASGVEGLDVVQLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTG
TNACYMEELRHIDLVEGDEGRMCVNTEWGAFGDDGWLEDIRTEFDREIDRGSLNPGKQLF
EKMVSGLFMGEMVRLILVKMARDGLLFEGRITAELLTKGKIETKHVSAIEKSKEGLTKAK
EILVRLGVEPSDDDCTAVQHVCTIVSSRSANLIAAVLAGILKRIKENKGVARLRTTVGID
GSLYKMHPQYARRLHKAVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQSRQIAQT
LSEFRLTTDQLLEVKQRMRTEIQNGLSKATQESATVKMLPTFVCSTPDGTENGDFLALDL
GGTNFRVLMVKIRSGKKRTVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKN
ARLPLGFTFSFPCLQTSLDAGVLVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVA
IVNDTVGTMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMIDSNEGRMCVNMEWGAFG
DNGCLDDIRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQIS
ETLKTRGIFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQL
CGAGMAAVVDKIRENRGLDYLNITVGVDGTLYKLHPHFSRIMHKTVKELAPHCHVNFLLS
EDGSGKGAALITAVGVRLRQEVNS
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagcccagctactagcgtactacttcgccgaacttaaggatgaccaggttaaa
aagattgacaagtacctgtactccatgcgcttctccgatgagacgctactggacatcacg
cagcgctttcgcatggagatggtcaaaggattgagccgcgaaacctacaccacgtcatct
ctaaagatgttgccgacgtttgtccgctccatccccgacggctccgagaaaggagacttt
atagcgttggatttgggaggaagtgccttcaggatccttcgcgtcaaagtcagtcatgag
aagaagcagacggttcagatggagagccagatatacgacacacctgaggacatcatgcac
gggagcggcactaggctattcgaccatgtggcagagtgtctgggtgacttcatggaaaag
cataacattaaagacaagaagctgccagttggcttcaccttctccttcccttgccagcaa
accaaacttgatgagccccgctttgtctgtctgcagagcactctgataacatggacgaag
cgcttcaaggcgagcggagtcgagggcttggatgttgtccagctgctcaacaaagccatc
aagaaacgaggcgactatgaagcggacatcatggctgtggtgaacgataccgtgggaact
atgatgacgtgtggcttcgacgaccaacgctgtgaagtcggaattattattggaactggc
accaatgcgtgctacatggaggagctgcgtcacatcgacctggtggagggtgacgagggc
aggatgtgtgtgaacactgagtggggagcctttggagacgacggctggttggaggacatc
cggacggagtttgaccgagagattgaccgtggctctctgaaccccggcaaacagctgttt
gagaagatggttagtggactgttcatgggcgagatggttcgcctaattctggtcaagatg
gccagggacggtctgctgtttgaaggaaggatcaccgctgagcttcttactaaagggaag
attgagaccaagcacgtgtccgccattgagaagagtaaggagggattaaccaaggccaaa
gagattttagtcagacttggtgtggagccctcggatgacgactgcactgccgttcaacat
gtttgcaccattgtctcttcccgctctgctaacctgatagcggcagtgcttgcgggcatc
ctcaagaggatcaaggagaacaaaggggtggcccgactgcgcaccactgttggcatcgac
ggatctctttacaagatgcacccacagtatgcccgtcgtcttcataaggcggtccgtcga
ctggtccccgactctgacgtgcggtttctcctgtcagagagcggtagtggaaaaggagcc
gccatggtgacggcggtggcctacagactcgctgagcaatcgaggcaaatcgcacaaact
ttgtcagagttccgcctgacgaccgatcagctgctggaggtaaagcagcgaatgaggact
gagatccaaaatggcctttcgaaggctacgcaggagtctgccaccgtgaaaatgttgcca
acgtttgtgtgcagcactcccgatggcacagaaaatggcgatttcctggccttggattta
ggaggaaccaacttcagggtactgatggtcaaaattcgttctgggaagaaaagaacagtg
gagatgcacaacaagatttatgccattcctctcgaagtgatgcagggaacaggagaggag
ctgtttgatcacattgtgcattgtataagtgacttcctggactacatggggatgaaaaat
gctcgtcttcctctgggcttcaccttctcattcccctgccttcagaccagcctggatgcc
ggcgttctggtgacgtggacaaaagggttcaaggcaacagactgtgaaggagaagatgtg
gtggggcttttgagagaggccataaaaagacgagaggaatttgacttggatgttgtggct
atagtcaatgacaccgtgggcaccatgatgacctgcgcgtacgaggaacccacctgtgag
attgggctcattgctggcaccggcagtaatgcctgttacatggaggagatgaggaacatt
gagatgatagactccaatgaagggcgaatgtgtgtcaacatggagtggggtgccttcggt
gataatggatgcctcgatgacatcaggaccgagtacgaccgtgctgtggatgacttctct
ctcaatccaggaaaacagagatacgagaaaatgtgcagtggtatgtaccttggcgaaata
gtgcggaacatcttaatagacttgaccaagaggggcttcctcttcagagggcagatttcg
gagacgctgaagaccagaggcatctttgaaaccaagttcctctctcagattgagagtgac
agattggcgttacttcaagtgagatccatcttgcaacaccttggcctggacagcacctgt
gatgacagtatcattgtcaaagaggtttgtggagcagtgtcacgtcgagccgctcagctc
tgtggggcaggaatggcggccgttgttgataaaatcagggaaaaccgtggcttggactat
ttgaacatcactgttggggtggatgggactctctacaaactccatccacacttctcccgg
atcatgcacaaaaccgtcaaggagctggctcctcactgccatgtcaacttcctgctgtcg
gaggacggcagtggcaaaggggcagcgctcatcacagctgtgggcgtccggttgagacaa
gaggtcaacagttaa

DBGET integrated database retrieval system