KEGG   Halomonas campaniensis: FF32_18625Help
Entry
FF32_18625        CDS       T03198                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00020  Citrate cycle (TCA cycle)
hcs00270  Cysteine and methionine metabolism
hcs00620  Pyruvate metabolism
hcs00630  Glyoxylate and dicarboxylate metabolism
hcs00680  Methane metabolism
hcs01100  Metabolic pathways
hcs01110  Biosynthesis of secondary metabolites
hcs01120  Microbial metabolism in diverse environments
hcs01130  Biosynthesis of antibiotics
hcs01200  Carbon metabolism
Module
hcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hcs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hcs_M00012  Glyoxylate cycle
hcs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hcs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FF32_18625
   00620 Pyruvate metabolism
    FF32_18625
   00630 Glyoxylate and dicarboxylate metabolism
    FF32_18625
  Energy metabolism
   00680 Methane metabolism
    FF32_18625
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FF32_18625
Enzymes [BR:hcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     FF32_18625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AIA76785
UniProt: A0A060BHF5
LinkDB All DBs
Position
complement(4023640..4024614)
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGGAGQISYSLIFRIAAGDMLGPDQPVILQLLEIPQAMDALNGVVMEVNDC
AFPLVQDIVATDDPNVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVRVLVVGNPANTNALIASCNAPDLDAGQFTAMTRLDHNRALTQLAQKTGKHVTDVDS
MIIWGNHSATQYPDLAQCKVDGKAAFDLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHMRDWALGCDGIVSMAIPSDGSYGIEEGIIYSYPVRCQGGKYEIVQGFELDAF
SKEKMQATEKELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatccagtacgtattgcgattaccggcggtgccggccagatcagctactctctt
attttccgcatcgccgctggcgatatgctggggccggatcagccagtcattctccagctt
ctcgaaattccccaagccatggacgccctgaatggcgttgtcatggaagttaacgactgt
gctttcccgctggtacaagacatcgttgccactgatgatccgaacgttgccttcaaagat
gccgatttcgccttgctggtaggtgcacgtccgcgtggcccgggtatggagcgtaaagat
ctgctggaagccaatgccgcgattttctctgtacaaggtaaagcgctgaacgatcacgct
agccgtgacgtgcgtgtactcgttgtcggtaacccggctaacaccaatgcattgattgct
tcttgcaatgcgccggacctcgatgcaggccagttcactgcgatgacgcgtttggatcac
aaccgtgcgctgacacagctggctcagaaaaccggcaagcacgttaccgacgtcgacagc
atgattatctggggcaaccacagtgctacccagtatccggatctggcgcagtgcaaagta
gacggcaaagccgccttcgatctggtcgagcgtgactggtacgaaaacgactttatcccg
acagtacagcagcgcggtgcggcgattatcaaagcacgcggcgcatcttctgcagcgtct
gcggcgtcttcagccattgatcacatgcgtgattgggcactgggttgcgatggtatcgtc
agcatggcgatcccgtctgacggcagctacggcattgaagaaggcataatctactcctac
ccagttcgttgtcagggtggcaagtatgaaatcgttcaaggctttgagttggacgcgttc
agcaaagagaagatgcaggctaccgagaaagaactgcgtgaagagcgcgcggctgttgag
cacctgctcggctaa

DBGET integrated database retrieval system