KEGG   Haloterrigena daqingensis: BB347_08825Help
Entry
BB347_08825       CDS       T04679                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hda  Haloterrigena daqingensis
Pathway
hda00564  Glycerophospholipid metabolism
hda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hda00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BB347_08825
Enzymes [BR:hda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BB347_08825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 FAD_binding_3 FAD_binding_2 DAO_C Pyr_redox NAD_binding_8 Thi4 Pyr_redox_3 3HCDH_N ApbA FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: APX96710
UniProt: A0A1N7C2Z0
LinkDB All DBs
Position
1797722..1799392
Genome map
AA seq 556 aa AA seqDB search
MADDTEVLVLGGGSTGCGIARDLAMRGLEVTLLERGTLTDGTTGRMHGLLHSGGRYAVSD
QASATECIEENEILRDVASHCVEETSGLFVQRPEDPDEYFQEKLEGCRDCGIPARVLSGR
EAREVEPYLADDVSRAIEVPDGAVDPFRLCVANALDAQNHGARIETHAEVIDLLREGDDI
YGVTVRHESGPGKRTHDTPGTTEEITAEYVVNATGAWAGQIGAMADLDVAVRPSKGVMTI
MNVRQVDTVINRCRPKGDADIIVPHETTAILGTTDEEVSDPDDYPEEQWEVDQMIDTLSE
LVPILEEARTIRSFWGVRPLYEPPGTGTTDPTDITRDFFLLDHAERDGVSGMTSIVGGKF
TTYRAMAEEISNHVCAKLGVSASCATAEEPLPGSENIEALEAGMDQFGLRSPVARRSTQR
LGSRAQEVLETNEANPVICQCEGVTRAEVCDAIEQSGSDLNAVRIRTRASMGNCQGGFCC
QNMANELHPTYDEATVRAALDELFQERWKGERHALWGEQLSQAMLNYALHATTMNRDQDP
ADASTGFDYARFDGGA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacaccgaggtcctcgtgctcggcggtggctcgactggctgtggtatcgcc
cgggatctggcgatgcgcggcctcgaggtcaccctcctcgagcgcgggaccctgaccgac
gggacgaccggccgcatgcacggcctcttacacagcggcgggcgatacgccgtctctgat
caggccagtgcgaccgagtgtatcgaggagaacgaaattttgcgagacgttgcgagccac
tgcgtcgaggaaaccagcggcttgttcgtccaacgacccgaggatcccgacgagtacttt
caggagaaactcgagggctgtcgcgactgtggaatccccgcgcgggtgctctcggggcgc
gaggcccgcgaggtcgaaccctacctcgcggacgacgtctcgcgcgcgatcgaggttccc
gacggcgcggtcgatccgttccgtctctgcgtcgcgaacgccctcgacgcgcagaatcac
ggcgcacgcatcgagacccacgccgaggtgatcgacctgctgcgtgagggtgacgacatc
tacggcgttacagttcgccacgagtcaggacccgggaagcgaacgcacgacacccccgga
acgaccgaggagatcaccgccgagtacgtcgtcaacgcgacgggcgcgtgggcgggccag
atcggagcgatggccgatctcgacgtcgcggttcggccttcgaagggcgtcatgaccatc
atgaacgtccggcaagtcgacacggtcatcaaccgctgtcggccgaaaggcgacgccgat
atcatcgttccccacgagacgacggcgattctcggcacgacggacgaggaagtctccgat
ccggacgactaccccgaagaacagtgggaggtcgaccagatgatcgacacgctctcggaa
ctcgtcccgattctcgaggaggcccgaacgatccgttcgttctggggcgttcgtccgctg
tacgaaccgccgggaacgggaacgacggacccaacggacatcacgcgggacttcttcctg
ctcgaccacgccgagcgcgacggcgtctccggcatgacgagcattgtcggcggcaaattc
acgacctaccgcgcgatggccgaagaaatctcgaaccacgtctgtgcaaaactgggtgtc
agcgcgtcgtgtgcgaccgccgaggagccactccccgggagcgagaacatcgaagcgctc
gaggccgggatggaccagttcgggcttcgatcaccggtcgctcgccgaagcacgcagcga
ctcggcagtcgggcacaggaggtcctcgagacgaacgaggcgaatcctgttatctgccag
tgcgagggcgtcacgcgcgccgaggtctgtgatgcgatcgagcagtcgggttcggacctg
aacgccgttcgcatccgcacgcgcgcctcgatggggaactgtcagggcggcttttgctgt
cagaacatggcgaacgaactccaccccacctacgacgaggcgacggttcgggccgcactc
gacgaactcttccaggagcgctggaagggcgagcgccacgccctctggggtgaacagctc
tcccaggccatgctcaactacgccctccacgcgacgacgatgaaccgggaccaggatccc
gccgacgcgtcgactgggttcgactacgcccgattcgacggaggtgcctag

DBGET integrated database retrieval system