KEGG   Helicobacter pylori BM012A: U063_0435Help
Entry
U063_0435         CDS       T02939                                 

Definition
(GenBank) Type II restriction enzyme MjaIII
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
heb  Helicobacter pylori BM012A
Brite
Enzymes [BR:heb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     U063_0435
Prokaryotic defense system [BR:heb02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    U063_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15 Carbpep_Y_N
Motif
Other DBs
NCBI-ProteinID: AHA87796
LinkDB All DBs
Position
421309..422067
Genome map
AA seq 252 aa AA seqDB search
MKNRLPFDTFLKSLKTSNRTLDFFTDWQKCLKNKNEISIALNHLNFLLGKDTKELKNCIK
TLFKEYPKAFNVLNILIAVRDKDDIVRDANGNFYPLHSYFENDEKVYEFIRQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMENHISSLFFQAQLNFKEQVDIREFEDLCQ
AFGDDIKKFDFVVCGKDTTYFMEANFYTISGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGTGWLDAKSKL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccgtctgccttttgatacttttttaaaaagtcttaagacaagcaatcgaact
ttagattttttcaccgattggcaaaagtgtctcaaaaataaaaatgaaataagtatcgct
ttaaaccacttgaattttttacttgggaaagatacaaaagagcttaaaaattgcattaaa
acactttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgaga
gataaagatgatatagtgcgtgatgctaatggtaatttttatcccctacattcttatttt
gaaaatgatgaaaaagtctatgagtttattcgtcaaacagggttggagcaaattttttgc
aacagaaacattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgcagcggaaaggctatggaaaatcatattagcagtctttttttt
caagctcaattaaattttaaagaacaagtagatattagagaatttgaggatttatgccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgcggtaaagatacaacttat
tttatggaagctaatttttataccattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcacaggttggctggatgctaaaagcaaactctaa

DBGET integrated database retrieval system