KEGG   Helicobacter pylori BM012A: U063_0735Help
Entry
U063_0735         CDS       T02939                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00473  D-Alanine metabolism
heb01100  Metabolic pathways
heb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    U063_0735
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    U063_0735
Enzymes [BR:heb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U063_0735
Peptidoglycan biosynthesis and degradation proteins [BR:heb01011]
 Precursor biosynthesis
  Racemase
   U063_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHA88085
LinkDB All DBs
Position
719750..720883
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNSASLRHNFSAVKSIVPKDACVMAVVKANAYGAGAIKASEIFLQEGANYL
GVATLDEALELRSHFPKTPILILGYSPNANASMLVDNDLSAMVFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIETIKKIRALKGLEIEGIFTHLSNADAKIKTHAKNQ
MKVFNAFLEQLLEQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNGMK
ESCPTILKNVISLKARIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNGIEAKEGDEVILFGDKSAKANDASEIAALLNTI
AYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaatagcgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcttgtgtcatggcggttgtcaaggcgaacgct
tatggagcaggtgcaataaaagcaagcgaaattttcttacaagaaggggctaattattta
ggggtagcgaccttagatgaagctttagagttgcgctctcatttccctaaaacccccatt
ttgattttaggctatagccctaatgctaacgcttccatgctggttgataacgatttgagc
gctatggtttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaattcatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaaccattaaaaaaatccgcgctttaaaaggcttggaaatagag
gggatattcacgcatttaagcaacgctgatgctaagattaaaacccatgctaaaaaccaa
atgaaagtctttaacgcttttttagagcagcttttagaacaaaaaatagagttccaatac
cgccatgcttataattccgccggtatcctttctttgtgtaacgggaatgaaaaccgcttg
ttaaatctttatcgcccagggatcatgctctatggtttttacccctctaatggaatgaaa
gaatcatgtccaaccatcttaaaaaatgttatcagcttaaaagctcgaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttataccaatgaagag
actttagtgggtgttttagctctagggtatgcagacgggttaatgcgcgctttaggcaat
cgcattcaagtagcgatcaataaccaattagcccccctgattggcaaggtgtgcatggat
caatgttttgtcaaactcaatggtattgaagccaaagagggcgatgaggtcattttgttt
ggggataaaagcgctaaagctaatgacgcaagcgaaattgctgcacttttaaacaccatt
gcttatgaaaccatcagcaccctatccaaacgcttggagcgtgtctatatttaa

DBGET integrated database retrieval system