KEGG   Helicobacter pylori F16: HPF16_1053Help
Entry
HPF16_1053        CDS       T01910                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hef  Helicobacter pylori F16
Pathway
hef00010  Glycolysis / Gluconeogenesis
hef00020  Citrate cycle (TCA cycle)
hef00620  Pyruvate metabolism
hef00640  Propanoate metabolism
hef00650  Butanoate metabolism
hef00680  Methane metabolism
hef01100  Metabolic pathways
hef01120  Microbial metabolism in diverse environments
hef01130  Biosynthesis of antibiotics
hef01200  Carbon metabolism
Module
hef_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF16_1053 (porA)
   00020 Citrate cycle (TCA cycle)
    HPF16_1053 (porA)
   00620 Pyruvate metabolism
    HPF16_1053 (porA)
   00640 Propanoate metabolism
    HPF16_1053 (porA)
   00650 Butanoate metabolism
    HPF16_1053 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPF16_1053 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF16_1053 (porA)
Enzymes [BR:hef01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF16_1053 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: BAJ55650
UniProt: E6NEU0
LinkDB All DBs
Position
1110625..1111848
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFIGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaagtgtgggatggcaataccgccagttct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaaca
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgctgcagctggtgga
agggtcagcactgcgactagctctcaaggtttagcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagcagggattctggctggataagt
ttatgcacatgcaacccccaagaggcttatgatttcaccttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacggatttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgtttaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaattgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgact
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagataagagctctccagcgggtgctatgggggcgatgtttaatgaa
gtaacgagcgcagtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcataggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system