KEGG   Halomonas elongata: HELO_2818Help
Entry
HELO_2818         CDS       T01311                                 

Gene name
adh2
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hel  Halomonas elongata
Pathway
hel00010  Glycolysis / Gluconeogenesis
hel00071  Fatty acid degradation
hel00350  Tyrosine metabolism
hel00625  Chloroalkane and chloroalkene degradation
hel00626  Naphthalene degradation
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_2818 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    HELO_2818 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HELO_2818 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HELO_2818 (adh2)
   00626 Naphthalene degradation
    HELO_2818 (adh2)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HELO_2818 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBV42702
UniProt: E1V3M3
LinkDB All DBs
Position
2112995..2114023
Genome map
AA seq 342 aa AA seqDB search
MDSTMKSAVVRTFREPLVIEEVPVPRPGPGEILVKVAASGVCHTDLHAARGDWPVKPEPP
FIPGHEGVGHVVAVGRGVQHVKEGDRVGVPWLYSTCGHCEHCLGGWETLCESQQNTGYSV
NGGFAEYTLAQADYVGKLPDNVGFVEIAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYARAMGLNVAAVDVDDAKLALAERLGATITVNAMQTDPARYLKQTIGGAHGALV
TAVSPKAFEQALGMIRRGGTVALNGLPPGDFPLPIFDMVLNGITVRGSIVGTRLDLQEAL
DFAGEGKVQATVKTEKLENINTVFDQMTQGHIEGRIVLDLAG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcacaatgaaatccgccgtcgttcggaccttccgcgaaccgctggtcatcgag
gaagtcccggtaccgcgtcccggccctggcgagattctggtcaaagtcgccgcttcaggc
gtctgccataccgatcttcacgcagcccgtggcgattggccggtgaagccggaaccgcct
ttcattcccggccacgaaggtgtcggtcacgtggtcgccgtaggtagaggggtccagcac
gtcaaggaaggagatcgggtcggggtaccctggctatactctacctgcgggcactgcgag
cactgcctcggtggttgggagacgttgtgcgaatctcagcagaatactggatattcggtc
aacggtggctttgccgaatataccctggcccaagcagactacgtcgggaagctgcccgac
aacgtcggcttcgtcgagatcgccccagtgctgtgtgctggagtcaccgtctataaaggc
ctgaaaatgaccgacacccgaccggggcaatgggtggtgatttccggtatcggtggcttg
ggccacatggcagtgcagtacgcccgggctatgggattgaatgtcgccgcagttgacgtc
gacgatgccaagctcgcactcgccgagcggctgggggcaacgatcaccgtcaacgccatg
caaaccgaccccgcccgttacctcaagcagacgatcggcggcgctcatggggcactcgtc
actgcggtatcgcccaaagccttcgagcaggcgctgggcatgatccgtcgtggcggcacc
gtggctctcaacggcctgccgccgggcgatttccccctgccgatctttgacatggtgctc
aatggtatcactgtgcgtggttcgatcgtcggtacccggctcgatctccaggaggcgctg
gacttcgccggtgaagggaaggtccaggccacggtgaaaaccgaaaaacttgaaaatatc
aatacggtgttcgaccaaatgactcagggacacatcgagggacgcatcgttctcgacctg
gcaggctaa

DBGET integrated database retrieval system