KEGG   Halomonas elongata: HELO_4243Help
Entry
HELO_4243         CDS       T01311                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_4243 (pykA)
   01230 Biosynthesis of amino acids
    HELO_4243 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_4243 (pykA)
   00620 Pyruvate metabolism
    HELO_4243 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    HELO_4243 (pykA)
Enzymes [BR:hel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HELO_4243 (pykA)
Exosome [BR:hel04147]
 Exosomal proteins
  Proteins found in most exosomes
   HELO_4243 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3805249..3806715
Genome map
AA seq 488 aa AA seqDB search
MPHSPIPARRTKIVATLGPASDRPGVLERMIAAGVDVVRLNFSHGSADDHRRRLVEVREI
ATRLGRSVAALGDLQGPKIRIARFRDGAVELEQGQTFVLDVALDGEAGDAGRVGCDYKAL
ADDVAPGDRLLLDDGRLVVDVTRVAGSEIHTTVVQGGRLSNNKGINKQGGGLSAPALTDK
DKADLATAIDIGVDYLAVSFPRSAADMHEARALLGSAGAEIGLVAKLERAEAVADDATLD
GIIEASEAVMVARGDLGVEIGDEALIGTQKRIIKHARSHNRAVITATQMMESMIEAPLPT
RAEVFDVANAVLDATDAVMLSAETAAGDFPVETIEAMARVCLGAERERIAQESGHRIHEG
FSRIDETIALSAMYAANHLAGVAAIACMTATGYTPLIASRIRSGLPIVGLAHNPVAQRRM
ALYRGVISLPFDTSEMTAGELNDRALERLVAQGIAEPGDHVILTRGDHMNAHGGTDTLKI
LAVETRHA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccccattcccccatacccgctcgccgcaccaagatcgtcgccaccctcgggccggcc
agcgacaggcccggcgtgctcgaacggatgatcgccgccggcgtcgatgtggtacgcctc
aacttctcccacggctcggccgacgaccatcggcgccggctcgtcgaggtgcgcgagatc
gccacccgactcggccgcagcgtggccgccctgggcgacctgcagggccccaagatccgc
attgcccgcttccgtgacggcgccgtggagctcgagcagggccagaccttcgtgctcgac
gtcgccctggatggcgaggccggcgacgccggtcgggtcggctgcgactacaaggccctg
gccgacgatgtcgcccccggcgatcgcctgctgctcgacgacggccgcctggtggtcgac
gtcacccgtgtggccggcagcgagatccacaccaccgtggtccagggcggccggctctcc
aacaacaagggcatcaacaagcagggcggtggcctctccgccccggcactgaccgacaag
gacaaggccgacctggcgaccgccatcgacatcggcgtcgactacctggcggtgtccttc
ccgcgcagcgccgccgacatgcacgaggctcgggcactgctcggcagcgccggcgccgag
atcggcctggtggccaagctcgagcgtgccgaggcggtggccgacgacgccaccctggac
ggcatcatcgaggccagcgaggcggtgatggtggcccgcggcgatctcggcgtggagatc
ggcgacgaggccttgatcggcacccagaagcgcatcatcaagcatgcgcgcagccacaac
cgcgcggtgatcaccgccacccagatgatggaatcgatgatcgaggcgccgctgccgacc
cgtgccgaggtgttcgacgtggccaatgccgtgctcgatgccaccgatgcggtgatgctc
tccgccgagaccgccgccggcgacttcccggtggagaccatcgaggccatggcgcgggtc
tgcctgggcgccgagcgcgagcgcatcgcccaggaatccgggcaccgcatccacgagggc
ttctcgcggatcgacgagaccatcgccctgtcggcgatgtacgccgccaaccacctcgcc
ggggtggcggccatcgcctgcatgacggccaccggctacacgccgctgatcgcctcgcgg
atccgctcggggctgccgatcgtcgggctggcccacaaccccgtcgcccagcggcgcatg
gcgttgtatcgtggggtgatctccctgcccttcgacaccagcgagatgaccgccggcgag
ctcaacgaccgcgcgctggagcgtctggtggcccagggcattgccgagccgggcgaccat
gtgatcctcacccggggcgatcacatgaatgcccacggcggcaccgacaccctgaagatc
ctggccgtggagacccgccatgcctga

DBGET integrated database retrieval system