KEGG   Helicobacter pylori 26695: C694_06240Help
Entry
C694_06240        CDS       T02282                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
heo  Helicobacter pylori 26695
Brite
Translation factors [BR:heo03012]
 Eukaryotic Type
  Elongation factors
   C694_06240
 Prokaryotic Type
   C694_06240
Mitochondrial biogenesis [BR:heo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    C694_06240
Exosome [BR:heo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C694_06240
  Exosomal proteins of breast cancer cells
   C694_06240
  Exosomal proteins of colorectal cancer cells
   C694_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1280697..1281896)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRPTQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagaacttgtagaaatggaagtgcgcgaattgttgagcgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggtaatgtgggtgaatggggtgaaaaagtgcttaaacttatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggtaggattgaaagaggc
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagacctacacaaaaaacgact
gtaaccggtgtagaaatgtttaggaaagagttggaaaaaggtgaagccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtggaacgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaattaccgcccgcaattctatgtgcgcaca
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgtgaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system