KEGG   Heterocephalus glaber (naked mole rat): 101699273Help
Entry
101699273         CDS       T02812                                 

Gene name
Kmt2b
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101699273 (Kmt2b)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101699273 (Kmt2b)
Transcription factors [BR:hgl03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101699273 (Kmt2b)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101699273 (Kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     101699273 (Kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 Bromodomain PHD_2
Motif
Other DBs
NCBI-GeneID: 101699273
NCBI-ProteinID: XP_004858983
LinkDB All DBs
Position
Un
AA seq 2744 aa AA seqDB search
MAAAAGGGSCPGPGSARGRFPGRPRGSGGGGSRGGRGSGAERVRVALRRGSGAAGPGGGE
PGEDTALLRLLGLRRGLRRLRRLWAGPRLHRGRGRGRGRGRGWGPSPSRGYVPEEESSDG
ESDDEEFQGFHSDEDVAPTSLRSALRSQRGRAPRGRGRKHKTTPLPPPPRLADVAPAPPK
TPARKRGEEGTERMVQALTELLRRAQAPPGPRSRACEPSTPRRSRGRPPGRPAGPSRKKQ
QAVVVAEAAVTIPKPEPPPPVVPVKHRTGSWKCKEGPGPGPGTLKRGGQSGRGGRGGRGR
GQGGLPLMIKFVSKAKRVKMEQLSLGLESGQGQGRHGESCQDDPQRQVGSEQGEGPYWKK
QEQKVEEEGEEKKEENKEEGEKEERTVVEEEVILAKEKEEAKPPSPPPTPPAPAPPSPLP
SPSASPPPPPCPPPPPVSPPPVPSPPPPPAPEEQEESPPPAVPVTCSRKRGRPPLTPSQR
AEREAARAGPEGTSPPTPNPSATTGAPLEDSPTVAPKSTTFLKNIRQFIMPVVSARSSRV
IKTPRRFMDEDPPKPLKVEVSPILRPPIAISPLAPQEPAPAPSPPRAPTPPSAPVPLPEK
RRSILREPTFRWTSLTRELPPPPPAPPPAPSPPAAPATPSRRPLLLRAAQFTPSEAHLKI
YESVLTTPLGAPEAPEPEPLPADDSPAEPEPRAVGRTNHLSLPRFAPVVTTPVKVEVPPH
GAPALSNGQQPQAQLQQPLQTLQTQLLPQALPPQQPQVQPQLQLQQQQAPQHILPLEKAR
IAGLGSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASASMPPSPGGQMEEAVGTVK
QTLDRGCVRSEDESVEAKRERASGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLS
ALPLRDRQDLTTEDTSSASETESVPSRSQRGKESAGPGGDLEPAGSGGVLAHTPRRSLPS
HHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMER
LAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPREEVVAPPGPEEQDSLLQRKS
ARRCVKQRPSYDIFEDSDDSDPGGPPAPRRRTPRENELPVPEPEEQSRPRKPTLQPVLQL
KARKRLDKDALGSGSFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTS
VPGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHRDTWCCRRCKFCHVC
GRKGRASKHLLECERCCHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWD
VEWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDED
YEILSGLPDSVLYTCGPCAGATQPRWREALSGALQGGLRQVLQGLLSSKVVGPLLLCTQC
GQDEKQLHPGPCDLQTVGQRFEEGHYTSVHSFMEDMVSILMRHSEGETSERRAGSQMKGL
LLKLLESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQESETPESGQP
PGDPSAAFQGKDPAAFSHMEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSA
EVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQD
DKKVFCQKHTDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIR
IDSLGILSDLSDFEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVHLE
TAEENQTIVHSPAPSLETPNHEDPIPDTDALILGAPEHHSPVQNLDPPLRPDSGSAPPPP
PPAPAPAPAPAPAPAPAPAPAPGPRSFSGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSS
LTHHIPTVGDPDFPAPPRRSRRPSPLAPRPPPSRRTSPPLRTSPQLRAPPPTSVVTVLTP
TSGELAPPGLAPSPPPPHEDLGPDFEDMEVVSGLSAADLDFAASLLGTEPFQEEIVAAGA
GGSSHGGPGDSSEEEASPTTHYVHFPVTVVSGPALGPGPLPGAPRIEQLDGVDDGTDSEA
EAVQQPRGQGTPPSGPVVGRAGVLGAAGDRARPPEDLPSEIVDFVLKNLGGPGEGAAGPR
EESLPPAPPLANGSQAPQGLPPSPADPTRTFAWLPGAPGVRVLSLGPAPEPPKPATSKII
LVNKLGQVFVKMAGEGEPVPAPVKQPPLPPTIPPAAPTSWTLPPGPLLGVLPVVGVGVVR
PAPPPPPPPLTLVFSSGPPSPPRQAIRVKRVSTFSGRSPPAPPPNKTPRLDEEGESLEDT
SQVPGLSSSGFSRVRMKTPTVRGTLDLDNLEEPPGEESLRPFQEQSSLLPLPEGGPPRAP
DGPSDLLLESWHQYSGEASSSEEEPPYPEDKENQVPKRAGPHLRFEITSEDGFSVEAESL
EGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIQHDAVIFLAEQLPGAQHCQHYKFR
YHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLASQHRVLPEGATCDEEEDEVQLRS
TRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRS
VLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKH
IVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN
NT seq 8235 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgccctgggcctggctccgcgcggggccgcttc
ccgggccggccgcggggctctggcgggggcgggagccgcggcggacggggcagtggggcc
gaaagagtgcgggtagctctgcggcgtggtagcggcgcagcggggccaggcggaggcgag
ccaggggaggacacggccctgctccgtttgctggggctccgccggggcctgcgccggctc
cgccgtctatgggcgggcccgcgccttcatcggggccggggccggggccggggccggggt
cgcggctggggcccgagcccgagccgaggctacgtgccagaggaggagagcagtgacggg
gaatccgacgatgaggagtttcagggttttcattcagatgaagatgtggcccccacttcc
ctgcgctctgcgctccgatcccagcgaggtcgagccccccgaggtcggggccgcaagcat
aagacgaccccccttcctcctcctcctcgcctagcagatgtggctcctgccccccccaag
acccctgctcgaaaacggggtgaggagggcacagaacggatggtgcaggcactgactgaa
cttctccggcgggcccaggcacccccaggcccccggagccgggcatgtgagccttccacc
ccccgtcggtctcggggacggcccccaggacgaccagcaggccccagccggaagaagcag
caagcagtagtggtagcagaagcagctgtgacaatccctaaacctgagcccccacctcct
gtggttccagtaaaacaccgaactggcagctggaagtgcaaggaggggcctggcccagga
cctgggaccctcaaacgtggaggacagtctgggagaggaggccgaggaggcaggggcaga
ggccaaggcgggctccccctcatgatcaagtttgtttccaaggccaaaagagtgaagatg
gaacagttgtccttgggacttgaatcaggtcagggtcaaggtcgacatggggaaagctgc
caggatgacccccaaagacaagttggatctgaacagggagagggtccttattggaaaaag
caggagcagaaggtggaggaggagggagaggagaaaaaagaagaaaacaaagaggaagga
gaaaaggaagaaagaactgtggttgaggaggaggtgatactagccaaggaaaaggaagag
gcaaagccaccatcaccacccccaactcctccagcccctgcgcctccttctcctcttcca
tccccttcagcatctcctccacctccaccttgccctccaccccctccagtgtccccccct
cctgtaccatcccctccaccacctccagccccagaagagcaagaagagtcccctcctcca
gctgtccctgttacatgctccaggaagaggggccggcctcccctgacccctagccagcgg
gcagagcgggaagctgctcgggcagggccagagggcacctctcctcccactccaaatccc
agtgcaaccacaggagcccctttggaagacagtcccactgtggcccccaaaagtaccacc
ttcctgaagaatatccggcagtttattatgcctgtagtgagtgcccgctcctcacgtgtc
atcaagacaccccggcgatttatggatgaagaccctcccaagcctctaaaagtggaggtc
tcacctattctgcgacctcccatcgccatctccccacttgctccccaggaaccagcacca
gctccttctccaccacgtgccccaactcccccatctgccccagtcccactccctgagaag
agacggtccatcctaagggaacccacatttcgctggacctcactaacccgggagctaccc
cctcctcctccagcccctcccccagccccatccccaccagctgcccctgccaccccctca
aggaggcccctgctccttcgggctgctcagtttaccccaagtgaagcccacctgaagatc
tatgaatcggtgcttactactcctcttggggctcctgaagcccctgaaccagagcctctt
cctgctgatgactctccagctgagcctgagccacgggcagtgggccgcaccaaccacctc
agcctgcctcgatttgcccctgtggtcaccacacctgttaaggttgaggtacccccccat
ggggctccagctctgagcaatgggcagcagcctcaggctcagctacagcaacccctgcag
accttgcagacccaactcctcccccaggcattgccgccacagcagccacaagtgcagcca
cagttacagctgcaacagcaacaagcaccacagcatatattgccactggaaaaggcacgg
attgcaggcctgggttccttgccgctgtctggagtggaggagaaaatgttcagcctcctt
aagagagccaaggtgcagctgttcaagattgaccagcagcagcaacagaaggtggcagcg
tcagcgtcaatgccgccaagccctggagggcagatggaggaggccgtggggactgtcaag
cagaccctagacagaggctgtgtcaggtctgaagatgagtctgtggaagctaagagagag
cgagcctcgggccctgagtcccctgtgcaaggcccccgcatcaaacacgtctgccgtcat
gctgctgtggccctaggtcaggcccgggccatggtacctgaagatgtcccccgcctcagt
gccctccctctccgggatcggcaggacctcaccacagaggatacgtcctctgcatctgag
actgaaagtgtcccatcccggtcccagaggggaaaggagtcagcaggtcctggaggagac
ttggagcctgcagggtctggtggggttctggcccatacaccccggcgctcactgccctcc
caccatggcaagaagatgcgtatggctcggtgtggacactgtcggggctgcctccgtgta
caggactgtgggtcttgtgtcaactgcctggacaagcccaagtttggaggtcccaacacc
aagaaacagtgctgtgtataccggaagtgtgacaagatagaggctcggaagatggaaagg
ctggcaaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatct
cctgaggcctcccctggtcctccaggcccacgccggggggcgggagctggggggccccgg
gaggaggtggtggcccccccagggcccgaggagcaggactccctcctgcagcgcaagtca
gcccggcgctgcgtcaaacagcgaccctcctatgatatcttcgaggattcagatgactca
gaccctgggggtcctcctgctcctcgtcgtcggactcccagagaaaatgagctgccagtg
ccagaaccagaggagcagagccgaccccgcaaacccaccctacagcctgtattgcagctc
aaggcccgaaagcgcctggacaaggatgctttgggctctggctcctttgcctcttttccc
aatggctggactggaaaacagaagtccccagatggtgtgcaccgggtccgtgtggatttc
aaggaggattgtgacctagagaacgtgtggctgatgggtggcctgagtgtgctcacttct
gtgccaggggggccaccaatggtgtgcttgctgtgtgccagcaaaggcctacatgagctg
gtgttctgccaagtgtgctgtgatcctttccacccattctgcctggaggaggctgaacgg
cccctgccccagcatcgtgacacttggtgttgccgccgctgcaaattctgccatgtctgt
ggacgtaaaggccgagcatccaagcacctactggaatgtgagcgctgctgccatgcttac
cacccagcctgcctgggccccagctacccaacccgggccacacgcaaacgacgccactgg
atctgttcagcctgtgtccgctgtaagagctgtggggcaactccaggcaagaactgggac
gtcgagtggtctggagattacagcctctgccccaggtgcacccagctctatgagaaagga
aactactgtccaatctgcacacgctgctatgaagacaatgactacgagagcaagatgatg
cagtgtgcacagtgtgatcactgggtacatgccaagtgtgaggggctctcagatgaagat
tacgagatcctttcagggctaccagactcggtgctgtacacatgtggaccatgtgctggg
gccacacagcctcgctggcgagaggccctgagtggggccctgcaagggggcctacgtcag
gtgctccagggcctgctgagctcgaaggtggtgggcccactgctgctgtgtacccagtgt
ggacaggatgagaagcagttgcacccaggaccctgtgatctgcaaactgtgggtcagcgc
tttgaggaaggccactacacatctgtgcacagctttatggaggacatggtgagcatcttg
atgaggcactcagaaggagaaacctcagagcgccgggctggaagccagatgaaggggctc
ctactaaagctgctagaatctgcgttcggctggttcgacgcccacgaccccaagtactgg
cgacggagtacccggctgccaaacggagtgctgcctaatgcggtgttgcccccatccctg
gaccatgtctatgctcagtggagacagcaggaatcagagaccccagaatcagggcagcct
ccaggcgatccctcagcagctttccaaggcaaggatccagctgctttctcacacatggaa
gaccctcgtcagtgtgcgctctgcctcaaatatggagatgcagactccaaggaggcaggg
aggctcctgtacatcggacagaatgagtggacccatgtcaattgtgccatttggtcagct
gaagtgtttgaggagaatgatggctccctcaagaatgtgcacgctgctgtggctcgtggg
aggcagatgcgctgcgaactctgtctgaagcctggagccacagtaggctgctgcctgtcc
tcctgcctcagcaactttcacttcatgtgtgcccgggccagctactgcatcttccaggat
gataaaaaagttttctgccagaaacacacagacctcctggatggcaaggagatcgtgacc
cctgatggttttgatgttctccgccgagtctatgtggactttgaaggcatcaacttcaag
cgaaagttcttgacagggcttgagcccgatgccatcaatgtgctcattggctccatccga
attgactccctgggtattctctctgatctctcggacttcgagggacggctcttccccatt
ggctaccagtgctcccgtctgtattggagcacagtggatgctcggaggcgctgctggtat
cggtgccgaattctggagtatcggccatggggcccaagggaagagcctgttcacctggag
acagcagaggaaaaccagaccattgtgcacagccctgccccttccttagagaccccaaat
catgaggaccccattccagatacagatgccctaatccttggagctcctgagcaccactca
cctgttcagaacctggaccccccacttcggccagattcaggcagtgctcctcctcctcct
cctcctgctcctgctcctgctcctgctcctgctcctgctcctgctcctgctcctgctcct
gctcctggccctcgctccttctcaggggctcgaatcaaagtgcccaactactcgccatca
cggaggcctttggggggtgtctcctttggccccctgccctcccctggaagtccatcttct
ctgacccaccacatccctacagtgggagacccggacttcccagctccaccgagacgctcc
cgtcgacctagccccctagcccccaggccaccaccatcacggcggacttcccctcctctc
agaacctcccctcagctcagggcgccccctcctacctcagttgttacagtcctcacacct
acctcaggggagctggctccccctggcctggccccatctcctccaccaccccatgaagac
ctgggcccagactttgaggacatggaggtggtgtcaggactgagtgctgctgacctggac
tttgcagccagcttgctagggactgagccctttcaggaagagattgtagccgcaggggca
ggggggagcagccatgggggcccaggggatagctcagaggaggaagccagccccactacc
cactatgtccacttccctgtgactgtagtgtctggccctgccctgggccctggccccctc
cctggagccccccgaattgagcaactggacggagtggatgatggcacagacagtgaggct
gaggcagtacagcagccccggggccaagggactcctccttcagggcctgtagtgggccga
gctggggtcctcggggctgcaggggatagggcccgacctcctgaggacctgccatcagaa
attgtggattttgttttaaagaacctagggggtcctggggagggggctgctggtcccaga
gaggagtcacttcccccagcacctcccctggccaatggcagccaggcccctcaaggtctg
ccccctagcccagcagaccccacccggacatttgcctggctccctggggccccaggggtc
cgggtattgagcctgggccctgctcctgagccccctaaacccgctacatccaagatcatt
cttgtcaacaagctggggcaagtatttgtgaagatggctggggaaggtgaacctgtccca
gccccagtaaagcagccacctctgccccctactattccccctgcagcccccacttcctgg
actctgcccccaggacccctgctgggggtgttgccagtggtaggagtaggggtggtccgc
cccgccccaccccctcctccgcctccactcacgctggtgtttagcagtgggccccccagc
ccaccccgccaggccatccgtgtcaagagggtgtctaccttctctggccgttccccacca
gcacctcccccaaataaaaccccccggctggatgaagagggggaatctttggaggacact
tcccaagttccaggcctcagcagcagtgggtttagccgagtaaggatgaaaacacccaca
gtgcgtggaactcttgacctggataatcttgaggagcctcctggggaggaaagccttcgg
cccttccaggaacaatcctctttgctgccacttccagaaggtggtcctcctcgggctcct
gatgggccctcagacctgctgcttgagtcatggcatcagtattcaggtgaagcctcgagc
tctgaggaagagcctccgtacccagaggataaagagaaccaggttccaaaacgagccggc
ccgcatcttcgctttgagatcaccagtgaggatggcttcagtgtggaggcagagagcttg
gaaggggcatggagaactctgattgagaaagtacaagaggcccgaggacatgctcggctc
agacatctctcttttagtggaatgagtggggcaaggctcctgggcatccaacatgatgct
gtcatcttcctggcagaacagctgcctggggctcagcactgccagcactataaattccgc
taccaccagcaaggcgagggccaggaggaaccacccctgaatccccatggggctgcccgt
gctgaggtctatctccggaagtgcacctttgacatgttcaatttcctggcttcccagcat
cgggtgctcccagaaggggccacctgtgatgaggaagaggatgaggtgcagctcaggtca
accagacgtgccaccagcctggagctgcccatggccatgcgctttcgccacctcaaaaag
acatccaaagaggctgtgggtgtctatagatcagccatccatggacgaggcctgttctgt
aaacgcaacattgatgctggagagatggtcattgaatactctggcattgtcattcgctct
gtgctgactgacaagcgggaaaagttctacgacgggaagggcatcgggtgctacatgttc
cgcatggatgactttgacgtggtggacgccacaatgcatggcaacgcagcccgcttcatc
aaccactcatgtgagcctaactgcttctctcgtgtcatccatgtggagggccagaagcac
atcgtcatctttgccctgcggcgtatccttcgtggtgaggagctcacctatgactacaag
ttccccatcgaggatgccagcaacaagctgccctgcaactgtggcgccaagcgctgccgt
cggttccttaactga

DBGET integrated database retrieval system