KEGG   Heterocephalus glaber (naked mole rat): 101711696Help
Entry
101711696         CDS       T02812                                 

Gene name
Aldh7a1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00053  Ascorbate and aldarate metabolism
hgl00071  Fatty acid degradation
hgl00260  Glycine, serine and threonine metabolism
hgl00280  Valine, leucine and isoleucine degradation
hgl00310  Lysine degradation
hgl00330  Arginine and proline metabolism
hgl00340  Histidine metabolism
hgl00380  Tryptophan metabolism
hgl00410  beta-Alanine metabolism
hgl00561  Glycerolipid metabolism
hgl00620  Pyruvate metabolism
hgl01100  Metabolic pathways
Module
hgl_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hgl_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101711696 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    101711696 (Aldh7a1)
   00620 Pyruvate metabolism
    101711696 (Aldh7a1)
  Lipid metabolism
   00071 Fatty acid degradation
    101711696 (Aldh7a1)
   00561 Glycerolipid metabolism
    101711696 (Aldh7a1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101711696 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    101711696 (Aldh7a1)
   00310 Lysine degradation
    101711696 (Aldh7a1)
   00330 Arginine and proline metabolism
    101711696 (Aldh7a1)
   00340 Histidine metabolism
    101711696 (Aldh7a1)
   00380 Tryptophan metabolism
    101711696 (Aldh7a1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101711696 (Aldh7a1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101711696 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101711696 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101711696 (Aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101711696
NCBI-ProteinID: XP_004854515
UniProt: G5BHU2
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRLARALRVEATKFSKFSGPCNRPTSFMSTLLINEPQYAWLKELGLLEENEGVYNGSWG
GQGEVITTYCPVNNEPIARVRQASVADYEETVKKAREAWQVWADIPAPKRGEIVRQIGDA
LREKIGVLGNLVSLEMGKILVESMGEIQEYVDICDYAVGLSRMIGGPVLPSERPGHVLIE
QWNPVGLVGIITAFNFPVAVYGWNNAIALISGNVCLWKGAPTTSLISVAVTKIVAKVLED
NKLPGAICSLTCGGADIGTTMARDEQVNLLSFTGSTQVGKQVALMVQERFGKCLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQVRVG
NPLEPNVLYGPLHTKQSVSKFLGAVEEAKKGGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
APIVHTETFAPILYIIKFKNEEEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGV
VNVNIPTNGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtttggctcgcgcgctccgtgtggaagctacaaagttcagcaagttctccgga
ccttgcaacaggcctacctccttcatgtccactctgctgatcaatgagcctcagtacgcg
tggctgaaagagctggggctcctcgaggagaacgagggcgtgtacaatggaagctggggc
ggtcagggcgaggttattactacctactgccctgttaacaatgagccaatagcaagagtc
agacaggccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcttggcaa
gtttgggcagatattcctgctccaaagcgaggagaaatagtaagacagatcggtgatgcc
ttgcgggagaagatcggagtactgggaaacttggtatctttggagatggggaaaatctta
gtggaaagtatgggagaaattcaggagtacgtggatatttgtgattatgctgttggcctg
tcgcggatgattggcggacctgtcctgccttctgaaaggcctggccatgtactcattgag
cagtggaatcctgttggccttgttggaattatcactgcattcaatttccccgtggcagtg
tatggctggaacaatgccatcgcattgatctctgggaatgtctgcctttggaaaggagcc
ccaacaacttccctcattagtgtagctgtcacaaagatagtcgccaaggttctagaggac
aacaagctgcctggggcaatttgttccttgacgtgtggtggagcagatattggcacaaca
atggccagagatgagcaggtgaacctgttgtccttcacagggagcacccaggtgggaaag
caggtggccctgatggtgcaggagagatttgggaaatgcttgctggagcttggaggaaac
aatgccattattgcttttgaggatgcggacctcagcttagttgttccatcagccctcttt
gccgccgtggggacagctggtcagaggtgcaccactgcgaggcgactgtttttacatgaa
agcattcatgatgaagttgtaaacagacttaaaaaggcctatgcccaggtccgtgttggg
aacccattggagcctaatgtgctgtacgggccgctccacaccaaacagtcagtgagcaag
tttctgggagcagtggaagaagcaaagaaaggaggaggcaccgtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaacccacaattgtgaccggtcttgcccacgat
gcacccattgtacacacagagacttttgcgccaattctctacatcattaaattcaagaat
gaagaagaggcctttgcatggaataatgaggtgaaacagggactttcgagcagcatcttt
accaaagatttgggcagaatcttccgctggcttggacctaaaggatcagactgtggtgtt
gtgaacgtcaacattcccaccaacggggctgaaattggaggagcatttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaagcagtacatgaggagatct
acttgtaccatcaactacagtaaggaccttcctctggcccaaggaatcaagtttgagtaa

DBGET integrated database retrieval system