KEGG   Heterocephalus glaber (naked mole rat): 101716322Help
Entry
101716322         CDS       T02812                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00250  Alanine, aspartate and glutamate metabolism
hgl00410  beta-Alanine metabolism
hgl00430  Taurine and hypotaurine metabolism
hgl00650  Butanoate metabolism
hgl01100  Metabolic pathways
hgl04727  GABAergic synapse
hgl04940  Type I diabetes mellitus
Module
hgl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    101716322
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101716322
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101716322
   00430 Taurine and hypotaurine metabolism
    101716322
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    101716322
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101716322
Enzymes [BR:hgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101716322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 101716322
NCBI-ProteinID: XP_004858524
LinkDB All DBs
Position
Un
AA seq 605 aa AA seqDB search
MKQDRLNRKHLEAPRAVVPGHAHGTVRSQRCLAVHPHLTLSKLRPARRDKHLEAPRLSRA
TPTARSLLGKFEVECIISHIFVIDNDWSTENDVKEDAHTENLMTNLSNVYASDLLPSEDG
KNLTKSFLLQVVNILLHYIKKSFDVKSKILDFHHPHQLLEGLEGFNLELSDHPKSLEQLL
VDCTDTLKYSVKTGHPRYFNQLSSGLDMIGLAGEWLTAAANTNMFTYEIAPVFTIMETIL
LKKMHEIVGWREIEADGIFSPGGSISNLYGILVARYKQYPEVKTKGMTALPCVTLFVSEQ
GHYSVKKAAALLGIGIDNVIEVKCDERGKMIPDELEKNISQAKRKGQTPFCVSATAGSTV
FGAFDPLQEIADICKKHKLWMHVDAAWGGGLLLSRKHSYKLSGIERANSVTWNPHKLMGV
PLQCSAILIQEKGLLEACNQMQAGYLFQPDKLYNVDFDTGDKAIQCGRHVDIFKLWLMWK
AKGTCGFEVQINRYMELANYFYKILKKKDNFKLVLDSEPELTNVCFWYFPPRLKHLPKGC
ERDQELHKIAPKIKAQMLEKGTAMISYQPCRDKVNFFRMVFSNPATRQTDVDYLIDEIER
LGKDL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggataggttaaacaggaagcaccttgaagctccgcgggccgtcgtcccgggc
cacgcccatggcacggtgaggtcgcagaggtgtcttgcagtccaccctcatctgacgctc
tctaagctgcgacctgccaggagagacaagcacctggaagctccgcggctgtcccgggcc
acgcccacggcacggtctcttttggggaaattcgaagtagaatgtattatatctcacatc
tttgtcattgacaacgattggtcaactgagaatgatgtgaaagaagatgctcatacagag
aatttaatgactaatttatcaaatgtttatgcttcagatttgttgccctctgaggatggt
aaaaatttaacaaaatcctttctcctacaagtggtaaatattcttctgcattacatcaaa
aaatcttttgatgttaagagtaaaatattggactttcatcatcctcatcagctccttgaa
ggtttggaagggtttaatttagagctgtctgaccaccctaaatctctggagcagttactc
gtggattgcacagacaccttaaaatacagtgttaaaacaggacatcctcgctattttaac
cagctttccagtgggctcgatatgattggacttgcaggggaatggctgacagctgctgca
aatacaaacatgtttacatatgaaatagccccagtatttactatcatggagacaattctt
ctcaagaaaatgcatgaaattgttggctggagagaaatagaagcagatggaatattttca
cctggcgggagtatatcaaacctctatggtatactagtagctcgttataagcaatatcca
gaggtaaaaacaaaaggcatgactgcacttccctgcgttacattatttgtatctgaacaa
ggtcactattcagtgaaaaaagctgcagcacttcttggtattgggattgataatgtaatt
gaagtaaaatgtgatgaaaggggaaagatgataccagatgagttagagaaaaatatatca
caagctaaaagaaagggccaaactccattctgtgtcagtgctaccgccggaagcacagtg
tttggagccttcgaccccctccaggagatcgctgatatttgtaagaagcacaaactctgg
atgcatgtggatgcagcttggggaggaggactactgctatccaggaagcattcctataaa
ctcagcggaattgagagggccaactctgtgacctggaatccacacaaactaatgggtgtt
ccccttcaatgctctgctatcctgatccaggaaaaaggtcttctggaagcatgcaaccag
atgcaagctggatatcttttccagccagataaactctacaatgttgattttgacactggg
gataaagctattcagtgtggtcgacatgttgatatcttcaagctatggctgatgtggaaa
gcgaagggaacctgtggctttgaggtacagatcaacagatatatggaacttgcaaattac
ttctataagattttaaagaaaaaagataattttaaactcgtgcttgattctgagcctgag
ctcaccaatgtctgcttctggtattttcctccaagacttaaacatctcccaaaaggttgt
gaaagagatcaagaactccacaagattgctcccaagattaaagcacagatgttagaaaaa
ggcacagccatgataagctaccagccatgcagagacaaagtaaatttttttcgaatggtc
ttttccaatcctgcgacaagacaaacagatgttgactatcttattgatgaaatagaaagg
cttgggaaggatttatga

DBGET integrated database retrieval system