KEGG   Heterocephalus glaber (naked mole rat): 101721664Help
Entry
101721664         CDS       T02812                                 

Gene name
Gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00052  Galactose metabolism
hgl00500  Starch and sucrose metabolism
hgl00520  Amino sugar and nucleotide sugar metabolism
hgl00524  Neomycin, kanamycin and gentamicin biosynthesis
hgl01100  Metabolic pathways
hgl01200  Carbon metabolism
hgl04910  Insulin signaling pathway
hgl04911  Insulin secretion
hgl04917  Prolactin signaling pathway
hgl04922  Glucagon signaling pathway
hgl04930  Type II diabetes mellitus
hgl04950  Maturity onset diabetes of the young
hgl05230  Central carbon metabolism in cancer
Module
hgl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101721664 (Gck)
   00052 Galactose metabolism
    101721664 (Gck)
   00500 Starch and sucrose metabolism
    101721664 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    101721664 (Gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101721664 (Gck)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    101721664 (Gck)
   04910 Insulin signaling pathway
    101721664 (Gck)
   04922 Glucagon signaling pathway
    101721664 (Gck)
   04917 Prolactin signaling pathway
    101721664 (Gck)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101721664 (Gck)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101721664 (Gck)
   04950 Maturity onset diabetes of the young
    101721664 (Gck)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101721664 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF4795
Motif
Other DBs
NCBI-GeneID: 101721664
NCBI-ProteinID: XP_004839982
UniProt: G5BIK4
LinkDB All DBs
Position
Un
AA seq 463 aa AA seqDB search
MDEARSRVQAALTLAEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTY
VRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEM
LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNV
VGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNV
ELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSVNPGQQLYEKLIGGKYMGEL
VRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDPGDRKQIHNILSTLGLRPSP
TDCDLVRRACESVSTRAAHMCSAGLAGVINRMRESRSQDVLRITVGVDGSVYKLHPSFKE
QFHSSVRRLAPRCEITFIESEEGSGRGAALVSAVACKKACMLG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggccaggagcagagtccaggcagccttgacgctggcggagcagatcctggca
gagttccagctgcaggaggaggacctgaagaaggtgatgcggcgaatgcagaaggagatg
gaccgtggactgcggctggagacccacgaggaggccagcgtgaagatgctgcccacctac
gtgcgttccaccccagaaggctcagaagtcggagacttcctgtccctcgacctggggggc
accaacttcagggtgatgctggtgaaggtgggggagggggaggagggacaatggagcgtg
aagaccaaacaccagatgtactccatccccgaggacgccatgacgggcaccgcagagatg
ctcttcgactacatctccgagtgcatctccgacttcctggataagcaccagatgaagcac
aagaaactgcccctgggtttcaccttctccttccctgtgaggcacgaggacatcgacaag
ggcatcctcctcaactggaccaagggcttcaaagcctcaggagcagaagggaacaacgtc
gtggggcttcttcgagacgccatcaagaggagaggggactttgagatggacgtggtggcc
atggtgaatgacacagttgccacaatgatctcctgctactatgaagaccaccaatgcgag
gtcggcatgattgtggggacgggctgcaatgcttgctacatggaggagatgcagaacgtg
gagctggtggaaggggacgagggccgcatgtgcgttaacaccgagtggggcgcctttggg
gactctggcgagctggacgagttcctgctggagtacgaccgcatggtggatgagagctcc
gtgaaccccggtcagcagctgtacgaaaagctcatcggcgggaagtacatgggcgagctc
gtgcggctcgtgctgctcaagctggtggacgagaacctgctgttccacggggaggcctcg
gagcagctgcgcacgcgcggagccttcgagacgcgcttcgtgtcgcaagtggagagcgac
ccgggtgaccgcaagcagatccacaacatcctgagcaccctggggctccggccctcgccc
acggactgcgacctcgtgcgccgcgcctgcgagagcgtgtccacgcgcgctgcgcacatg
tgctccgctgggctggcgggcgtcatcaaccgcatgcgcgagagccgcagccaggacgtg
ttgcgtatcaccgtgggcgtggacgggtcggtgtacaagctgcaccccagcttcaaggag
cagttccactccagcgtgcgcaggctggcgccccgctgcgagataacattcatcgagtct
gaggagggcagcggccggggcgccgcgctggtgtccgcggtggcctgcaagaaggcctgc
atgctgggctag

DBGET integrated database retrieval system