KEGG   Heterocephalus glaber (naked mole rat): 101721664Help
Entry
101721664         CDS       T02812                                 

Gene name
Gck
Definition
(RefSeq) glucokinase
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Glucagon signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101721664 (Gck)
   00052 Galactose metabolism
    101721664 (Gck)
   00500 Starch and sucrose metabolism
    101721664 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    101721664 (Gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101721664 (Gck)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    101721664 (Gck)
   04910 Insulin signaling pathway
    101721664 (Gck)
   04922 Glucagon signaling pathway
    101721664 (Gck)
   04917 Prolactin signaling pathway
    101721664 (Gck)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101721664 (Gck)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101721664 (Gck)
   04950 Maturity onset diabetes of the young
    101721664 (Gck)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101721664 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 463 aa AA seqDB search
MDEARSRVQAALTLAEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTY
VRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEM
LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNV
VGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNV
ELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSVNPGQQLYEKLIGGKYMGEL
VRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDPGDRKQIHNILSTLGLRPSP
TDCDLVRRACESVSTRAAHMCSAGLAGVINRMRESRSQDVLRITVGVDGSVYKLHPSFKE
QFHSSVRRLAPRCEITFIESEEGSGRGAALVSAVACKKACMLG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggccaggagcagagtccaggcagccttgacgctggcggagcagatcctggca
gagttccagctgcaggaggaggacctgaagaaggtgatgcggcgaatgcagaaggagatg
gaccgtggactgcggctggagacccacgaggaggccagcgtgaagatgctgcccacctac
gtgcgttccaccccagaaggctcagaagtcggagacttcctgtccctcgacctggggggc
accaacttcagggtgatgctggtgaaggtgggggagggggaggagggacaatggagcgtg
aagaccaaacaccagatgtactccatccccgaggacgccatgacgggcaccgcagagatg
ctcttcgactacatctccgagtgcatctccgacttcctggataagcaccagatgaagcac
aagaaactgcccctgggtttcaccttctccttccctgtgaggcacgaggacatcgacaag
ggcatcctcctcaactggaccaagggcttcaaagcctcaggagcagaagggaacaacgtc
gtggggcttcttcgagacgccatcaagaggagaggggactttgagatggacgtggtggcc
atggtgaatgacacagttgccacaatgatctcctgctactatgaagaccaccaatgcgag
gtcggcatgattgtggggacgggctgcaatgcttgctacatggaggagatgcagaacgtg
gagctggtggaaggggacgagggccgcatgtgcgttaacaccgagtggggcgcctttggg
gactctggcgagctggacgagttcctgctggagtacgaccgcatggtggatgagagctcc
gtgaaccccggtcagcagctgtacgaaaagctcatcggcgggaagtacatgggcgagctc
gtgcggctcgtgctgctcaagctggtggacgagaacctgctgttccacggggaggcctcg
gagcagctgcgcacgcgcggagccttcgagacgcgcttcgtgtcgcaagtggagagcgac
ccgggtgaccgcaagcagatccacaacatcctgagcaccctggggctccggccctcgccc
acggactgcgacctcgtgcgccgcgcctgcgagagcgtgtccacgcgcgctgcgcacatg
tgctccgctgggctggcgggcgtcatcaaccgcatgcgcgagagccgcagccaggacgtg
ttgcgtatcaccgtgggcgtggacgggtcggtgtacaagctgcaccccagcttcaaggag
cagttccactccagcgtgcgcaggctggcgccccgctgcgagataacattcatcgagtct
gaggagggcagcggccggggcgccgcgctggtgtccgcggtggcctgcaagaaggcctgc
atgctgggctag

DBGET integrated database retrieval system