KEGG   Heterocephalus glaber (naked mole rat): 101722267Help
Entry
101722267         CDS       T02812                                 

Gene name
Tgm6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101722267 (Tgm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101722267
NCBI-ProteinID: XP_004841212
LinkDB All DBs
Position
Un
AA seq 752 aa AA seqDB search
MSKGPEPEASTAGSRNSLEASAIKKVESGEEKEKTQKDTKGLNHEGFVGVRVTKVDWQQT
RNGAAHRTREYSCCELVVRRGQLFSIRLYLTGVLDREETLTLTVETGSQASEALHTKAVF
QTAHLEVGDAWTAAKEAQTGNTVTVSLASPPDAVIGRYLLSARASSRRKHGDRKLGEFVL
LFNPWCPEDDVFLASEEERQEYVLNDSGIIYRGVEKHIRAQGWNYGQFEEDILNICLSIL
DRSPSYQEDPATDVSCRHNPVYVTRVVSAMVNSNNDRGVVQGQWQGKYSGGTSPLHWRGS
VAILQKWFKGKYKPVKYGQCWVFAGVMCTVLRCLGIPTRVVSNFNSAHDTDKNLSVDKYV
DSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYDGWQVLDATPQEESEGMFQCGPASV
TAIREGDIHLAHDGPFVFAEVNADYITWLWHKDESQERVYSDTKKIGRCISTKAVGSDSR
VDITSLYKYPEGSQKERQVYRKAMKKLLSVEAWGKRSQIQRASRHSLQHDDLLEPPTKPS
ITGKFKVLEPPVLGHDLKLALSLASLTSQVLQVQVNLSGATILYTRRPVAEILHESHTVR
LDPQEEKKIPITISYSQYKENLTEDKKILLAAMCLVTKGEKLLVEKDITLEDFIIIKVLG
PATVGVAVAVEVTVVNPLSERVKDCVLMVEGSGLLQGQLSINIPTLQPQERALVQFSITP
TRSGPRQLQVDLVSPHFPDIKGFVIIHVAAAK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaggccctgaaccagaagcaagcacagcaggttcaaggaacagtctggaagcc
agtgcaattaaaaaggttgagtcgggagaagagaaagagaagactcagaaagataccaaa
gggctcaatcatgaaggatttgtgggggtcagagtcaccaaagtggattggcagcagaca
aggaatggcgctgcccacagaacccgggaatactcttgctgtgagctggtggttcgcaga
ggccagctgttcagcatcaggctgtatctgactggagtcctagacagagaggagaccctc
accctcacagtggagacagggtctcaggcttccgaggccctccacaccaaagctgtgttc
cagacagcacatctggaggtgggtgatgcatggacagcagcgaaggaggcacagaccggg
aacaccgtgactgtcagccttgccagtcctccagatgctgtcattggccgctacctgctg
agtgccagggcttcctcccgccgcaagcacggcgaccggaagctgggcgagtttgttctg
cttttcaatccatggtgcccagaggacgatgtatttctggcctcggaggaggagagacag
gagtatgtgctcaacgacagtggcatcatctaccgcggtgtggagaagcacattcgagcc
cagggctggaactacgggcagtttgaggaggacatcctgaacatctgcctctccatcctg
gaccgaagccccagttaccaagaagacccagccacagacgtgtcctgccgccacaaccct
gtctatgtcaccagggtcgtcagtgccatggtgaacagcaacaatgaccggggcgtggta
caaggccagtggcagggcaaatacagcggtggcaccagcccgctgcactggagaggcagc
gtggccattctgcagaagtggttcaagggcaagtacaagccagtcaaatacggccagtgc
tgggtcttcgcgggagtgatgtgtacagtcctcagatgcctggggatcccaacacgggtg
gtgtccaacttcaactcagcccacgacaccgacaagaacctgagtgtggacaaatacgtg
gactcctttgggcggaccctggaggacttgacagaagacagcatgtggaatttccatgtc
tggaacgagagctggtttgcccgacaggatctgggcccctcttacgatggctggcaggtt
ctggacgctaccccccaggaagagagcgaaggcatgttccagtgtggcccagcctcagtc
acagccatccgcgagggcgacatacatttggcccatgatggccccttcgtgttcgcggag
gtcaatgcagactacatcacctggctgtggcacaaggatgagagccaggagcgtgtgtac
tcagacacaaagaagatcgggaggtgcatcagcaccaaggcagtaggcagtgactcccgc
gtggacatcaccagcctctacaagtacccagaagggtctcagaaggagaggcaggtgtac
cgcaaggccatgaagaagctgctcagtgtggaagcctgggggaagaggtcgcagatccaa
agggccagcaggcacagcctccagcatgatgacctcctggagccgcccaccaagcccagc
atcactggcaagttcaaggtgctggaaccgccagtgctgggccatgacctgaagctggct
ctgagcttggccagcctcacctcccaggtcctgcaagtccaggtcaatctgagtggtgcc
accattctctacacccgcaggccagtggcagaaatcctgcatgagtcccacacagtgagg
ctggacccgcaagaagaaaagaaaattccaatcacaatatcttactctcagtacaaagag
aacctgactgaggacaagaagatcctgttggctgccatgtgccttgtcaccaaaggagaa
aagctcctggtggagaaggacattactctggaggactttatcatcatcaaggtgctgggc
ccagccacagtgggagtggcagttgctgtagaagtgaccgtggtcaaccccctctcagaa
agagtgaaggattgtgtgctgatggtggaaggcagtggccttcttcaaggacagcttagc
attaacatacccaccctgcagccccaggagagggccttggtccagttcagcatcacccca
accaggagtggcccacggcagctgcaggtggacctcgtcagcccccacttcccagacatc
aagggcttcgtgatcatccacgtggccgcagccaagtga

DBGET integrated database retrieval system