KEGG   Halorhodospira halophila: Hhal_0830Help
Entry
Hhal_0830         CDS       T00462                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hha  Halorhodospira halophila
Pathway
hha00020  Citrate cycle (TCA cycle)
hha00270  Cysteine and methionine metabolism
hha00620  Pyruvate metabolism
hha00630  Glyoxylate and dicarboxylate metabolism
hha00680  Methane metabolism
hha00710  Carbon fixation in photosynthetic organisms
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
Module
hha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hha_M00012  Glyoxylate cycle
hha_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hhal_0830
   00620 Pyruvate metabolism
    Hhal_0830
   00630 Glyoxylate and dicarboxylate metabolism
    Hhal_0830
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hhal_0830
   00680 Methane metabolism
    Hhal_0830
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hhal_0830
Enzymes [BR:hha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Hhal_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ABM61606
JGI: Hhal0830
UniProt: A1WV94
LinkDB All DBs
Position
complement(912176..913156)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVTLQLLEIPQAQEALQGTVMELEDC
AFPLVDGIIATDSAEEAFRDADYVLLVGAKPRGPGMERKDLLEANAAIFSAQGQALNAVA
KRDVKVLAVGNPANTNALITQRNAPDLDPRNFTAMTRLDHNRALAQLSNKVGCHSTEIRG
LAVWGNHSATQYPDISHCTIQGRPAADQVEHAWVKDTFIPTVQQRGAAIIKARGASSAAS
AASAAIDHMRDWALGTPEGEWTSMAVPSDGSYGIEAGLIYSFPVTCRGGDYKIVSGLSVD
DFSRARMDQTAAELAEERDAVAHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacccgtgcgagtcgctgtcaccggggcggccggccagatcggctacagcctg
ctgttccgcatcgccgccggcgagatgctgggcaaggatcaaccggtgaccctgcaactg
ctcgagatcccgcaggcccaggaggcgctgcagggaacggtgatggagcttgaggactgc
gccttcccgctggtcgacggcatcatcgccacggacagcgccgaagaggccttccgagac
gccgactacgttctgctcgtcggcgccaagccccgtggcccgggcatggagcgcaaggac
ctgctcgaggccaatgcggcgatcttctcggcccagggccaggcgctcaacgccgtggcc
aagcgcgacgtcaaggtcctggcggtgggcaacccggccaacaccaacgccctgatcacc
cagcgcaacgcgccggatctggacccgcggaacttcaccgccatgacccggctcgaccac
aaccgcgccctggcgcagctctccaacaaggtcggctgccactccaccgagatccgcggc
ctggccgtgtggggcaaccactccgccacccagtacccggacatcagccactgcaccatc
cagggccgcccggccgccgaccaggtcgagcacgcctgggtgaaggacaccttcatcccc
accgtgcagcagcgcggcgcggccatcatcaaggcccgcggcgcctccagcgcggcgtcg
gcggccagtgccgccatcgaccacatgcgcgactgggccctgggcacccccgagggcgag
tggaccagcatggccgtgccgtcggacggcagctacggcatcgaggcggggctgatctac
tccttcccggtgacctgccggggcggtgactacaagatcgtgtcggggctgtcggtggac
gacttcagccgcgcacgcatggaccaaaccgccgccgagctcgccgaagagcgtgacgcg
gtggcgcatctgctgccctga

DBGET integrated database retrieval system