KEGG   Halorhodospira halophila: Hhal_0830Help
Entry
Hhal_0830         CDS       T00462                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
hha  Halorhodospira halophila
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hhal_0830
   00620 Pyruvate metabolism
    Hhal_0830
   00630 Glyoxylate and dicarboxylate metabolism
    Hhal_0830
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hhal_0830
   00680 Methane metabolism
    Hhal_0830
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hhal_0830
Enzymes [BR:hha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Hhal_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(912176..913156)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVTLQLLEIPQAQEALQGTVMELEDC
AFPLVDGIIATDSAEEAFRDADYVLLVGAKPRGPGMERKDLLEANAAIFSAQGQALNAVA
KRDVKVLAVGNPANTNALITQRNAPDLDPRNFTAMTRLDHNRALAQLSNKVGCHSTEIRG
LAVWGNHSATQYPDISHCTIQGRPAADQVEHAWVKDTFIPTVQQRGAAIIKARGASSAAS
AASAAIDHMRDWALGTPEGEWTSMAVPSDGSYGIEAGLIYSFPVTCRGGDYKIVSGLSVD
DFSRARMDQTAAELAEERDAVAHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacccgtgcgagtcgctgtcaccggggcggccggccagatcggctacagcctg
ctgttccgcatcgccgccggcgagatgctgggcaaggatcaaccggtgaccctgcaactg
ctcgagatcccgcaggcccaggaggcgctgcagggaacggtgatggagcttgaggactgc
gccttcccgctggtcgacggcatcatcgccacggacagcgccgaagaggccttccgagac
gccgactacgttctgctcgtcggcgccaagccccgtggcccgggcatggagcgcaaggac
ctgctcgaggccaatgcggcgatcttctcggcccagggccaggcgctcaacgccgtggcc
aagcgcgacgtcaaggtcctggcggtgggcaacccggccaacaccaacgccctgatcacc
cagcgcaacgcgccggatctggacccgcggaacttcaccgccatgacccggctcgaccac
aaccgcgccctggcgcagctctccaacaaggtcggctgccactccaccgagatccgcggc
ctggccgtgtggggcaaccactccgccacccagtacccggacatcagccactgcaccatc
cagggccgcccggccgccgaccaggtcgagcacgcctgggtgaaggacaccttcatcccc
accgtgcagcagcgcggcgcggccatcatcaaggcccgcggcgcctccagcgcggcgtcg
gcggccagtgccgccatcgaccacatgcgcgactgggccctgggcacccccgagggcgag
tggaccagcatggccgtgccgtcggacggcagctacggcatcgaggcggggctgatctac
tccttcccggtgacctgccggggcggtgactacaagatcgtgtcggggctgtcggtggac
gacttcagccgcgcacgcatggaccaaaccgccgccgagctcgccgaagagcgtgacgcg
gtggcgcatctgctgccctga

DBGET integrated database retrieval system