KEGG   Halobacillus halophilus: HBHAL_1329Help
Entry
HBHAL_1329        CDS       T02031                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00053  Ascorbate and aldarate metabolism
hhd00071  Fatty acid degradation
hhd00280  Valine, leucine and isoleucine degradation
hhd00310  Lysine degradation
hhd00330  Arginine and proline metabolism
hhd00340  Histidine metabolism
hhd00380  Tryptophan metabolism
hhd00410  beta-Alanine metabolism
hhd00561  Glycerolipid metabolism
hhd00620  Pyruvate metabolism
hhd00625  Chloroalkane and chloroalkene degradation
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_1329
   00053 Ascorbate and aldarate metabolism
    HBHAL_1329
   00620 Pyruvate metabolism
    HBHAL_1329
  Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_1329
   00561 Glycerolipid metabolism
    HBHAL_1329
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HBHAL_1329
   00310 Lysine degradation
    HBHAL_1329
   00330 Arginine and proline metabolism
    HBHAL_1329
   00340 Histidine metabolism
    HBHAL_1329
   00380 Tryptophan metabolism
    HBHAL_1329
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HBHAL_1329
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HBHAL_1329
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HBHAL_1329
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HBHAL_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: CCG43703
UniProt: I0JHT5
LinkDB All DBs
Position
332795..334249
Genome map
AA seq 484 aa AA seqDB search
MSPQTYFKQYINGEWRPGSSEKQIENINPYTEQAIITIPSANEDDLNEAYRSAEQAQKDW
ADLLPAKKQAYFDSLLSVVKERKDEIIDWLVKEAGSTLVKAEVEYQAAVSIIKESSSFPT
RMSGEILPSNTPGKENRVYRYPKGVIGVIGPWNFPFHLAMRSIAPAIATGNAVVAKPASE
SPVTAGLLIADLFEAAGFPAGVLNVVVGRGSEIGDAFVTHPVPKLISFTGSTEVGSHIGE
LAGKHIKDTALELGGNNAMIVLDDADVEKAVEAAAFGRFLHQGEICMSINRLIVHEQIHD
QFVEAFKEKVETLKVGDPSEKDTTVGPLINHGAIERIQEDLQASLDRGATLLTGGDAEGN
IMHPTVLTNVTNDMPIASNEVFGPVIGIIKVSSEEEAITVANDTSYGLSGSVFTTDVHRG
VETAKQINTGMIHVNDQSVNDEAHVAFGGEKSSGLGRFGGEWALDKFTTVKWIGVMNGYR
KFPF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtccacaaacttattttaaacaatatattaatggcgaatggcgcccaggttcaagc
gagaaacagattgaaaatataaatccatataccgaacaagctattatcacaatcccttct
gccaatgaagatgatttaaatgaggcctaccgatcagctgaacaagctcaaaaagactgg
gcagacttactcccagctaagaagcaggcgtattttgacagtttgttatcggtagttaag
gaacgcaaagatgaaattatagactggttggtgaaggaagcaggaagcactttggtaaaa
gcagaagtggaataccaggccgcagtatccattattaaagaatcttcctcttttcctaca
aggatgtctggagagatccttccttctaatactcctggcaaagaaaaccgggtttatcgt
tatccgaaaggagtcataggagtaattggtccgtggaattttccattccacttagctatg
aggtcgattgctcctgcgattgctactggaaacgcagttgtggccaagccagcatcagaa
tctcctgttactgcaggattactgattgccgatttatttgaagcagccggatttccagca
ggagtgctgaacgtagtagtaggaagaggttcagagatcggggatgcgtttgttacacac
ccggtacctaaactgatttcctttactggatcaacagaagtaggcagtcacattggagag
cttgcaggtaagcacatcaaagatacggcactggagcttggaggcaacaatgctatgatt
gtccttgatgatgccgatgtagaaaaagcggtggaagcagcagcctttggaaggttcctg
caccagggtgaaatttgcatgtccatcaatcgcttgatcgttcatgaacagattcatgat
caattcgtggaagcattcaaagaaaaagtggaaactttaaaagttggtgacccatctgaa
aaagatacaacagttggcccgttgattaaccatggagccatcgaacgtattcaggaagat
ctgcaggcttcccttgatcgtggcgccaccttgctaacaggtggtgatgcagaagggaac
atcatgcatcctactgtactaaccaatgttaccaatgatatgccaattgcaagcaatgaa
gtattcggtcctgtaattggaatcattaaggtttcaagtgaagaagaagccattacagtg
gcgaatgatacttcctatggcttaagtgggtcggtattcacaacggatgtacaccgcggt
gttgaaacagcaaaacagattaacacaggaatgattcatgtgaatgatcagtctgtaaac
gatgaagcacatgtagccttcggcggtgagaaaagttccggactcggccgctttggagga
gagtgggctctcgacaaatttacaacggtaaaatggattggtgtcatgaatggatatcgc
aaatttccattttaa

DBGET integrated database retrieval system