KEGG   Halobacillus halophilus: HBHAL_1948Help
Entry
HBHAL_1948        CDS       T02031                                 

Gene name
npr1
Definition
(GenBank) neutral protease
  KO
K08777  neutral peptidase B [EC:3.4.24.-]
Organism
hhd  Halobacillus halophilus
Pathway
hhd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HBHAL_1948 (npr1)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     HBHAL_1948 (npr1)
Peptidases [BR:hhd01002]
 Metallo Peptidases
  Family M4: thermolysin family
   HBHAL_1948 (npr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: CCG44309
UniProt: I0JJJ1
LinkDB All DBs
Position
951586..953250
Genome map
AA seq 554 aa AA seqDB search
MKKKVVSSTLTLTLALSGLGIGASSIHADDSKLKMNEKYGTPSYIIENWEMPKFSSLTKQ
SHSVEDIALSYLNYQKDKFKLKGNSNENFKVLDTQKDAKAGTSHVRLTEQYKGVPVYGAH
QTVTLNEEDEVKAFFGKVVPNMDEKGIDTNAEITGEQAIETTKASIEKEIGEVEAYDAPP
SSELFIYEFDGKFQLTYLVKASTSDPEPGYFHYFIDAKTGEIVDNYNAIDHVKAFGEGVL
GNKEMFEVTFQEGDYYMFDGTRGDGVHTFDALNMEPGWFNLFSQLLGYHGEEVTSGHKYF
GDAAAVDAHKNAGIVYDYFKETFNRDSFDGNGARMISSVHVGENWNNAAWNGVQMMYGDG
DGETFIPLSGAVDVIGHELTHAVTDRSADLVYQDEPGALNESLSDILGAMVDRDDWWMGE
DIYTPGKEGDGLRSLKDPSQVPHPFYPDRGYPDHYSELYTGELDNGGVHINSSINNKAAY
LVSEGGTHYDVEVEGVGREATEQIYYRALTKYLTATSDFSMMRQAAIQSAVDLYGENSME
VSAVMQAYDAVGVE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagtagtttcatcgacacttacgttaacgctagctctaagcggtcttggt
atcggggccagcagtatccatgcggacgattcaaaattaaaaatgaatgaaaagtatggt
accccgtcttatattattgaaaactgggagatgcccaagttttcatccttaactaagcag
tcgcattccgtagaagatattgctttgtcttatcttaactatcaaaaagataagttcaaa
ctaaaaggaaacagtaacgagaatttcaaagtcctagatactcaaaaagatgcaaaagcg
ggtacttcccacgtgcgtttaactgagcagtataaaggagtgccagtctatggggctcat
cagactgttaccctgaatgaggaggatgaagtaaaagccttctttggcaaggttgtaccg
aatatggatgaaaaaggaatagacacaaacgctgaaattacaggagagcaagcaatcgaa
acaactaaagcttctattgagaaggaaatcggggaggtagaggcttatgacgcaccacct
tccagtgaacttttcatttacgaatttgatggaaagtttcaactgacctatttagtaaaa
gcttcaacctcagatcctgaaccgggttatttccattacttcatcgatgctaaaacagga
gagatcgtggataactacaacgcgattgatcacgtaaaagcatttggagaaggggtcctt
ggaaataaagaaatgtttgaagtgactttccaagagggagattactacatgtttgacggg
acccgtggagacggcgttcatacattcgatgccctcaatatggaacccggatggtttaac
ctattttctcaattgcttggttaccatggagaagaagtcacgagcggtcataagtacttt
ggtgatgcggctgcagtggatgctcataagaacgcagggatcgtttatgactattttaaa
gaaaccttcaatcgagattcatttgatggcaacggggctagaatgatttcctccgttcac
gtaggtgaaaactggaataatgccgcttggaacggtgtacaaatgatgtacggcgacggg
gacggtgaaacttttattccgttatcaggagctgtcgatgttattggtcatgagttgaca
cacgctgttaccgatcgttcggctgatcttgtatatcaggatgaacctggtgctttaaat
gaatcgctgtctgacattttaggagccatggtagatcgggatgattggtggatgggagaa
gacatctatacgccaggaaaagaaggcgatggtctccgttctctgaaagatccatctcag
gtgcctcatccattttatcctgacaggggctatccggatcattatagtgaattgtacacc
ggagagttagataacggtggcgtccatattaattcaagtattaataataaggctgcttat
ctagtctcggaaggcggaactcattatgatgtggaggtagaaggagtaggaagagaggca
actgaacaaatctactatcgtgctttaacgaaatatctaacggcgacttcagacttcagt
atgatgaggcaagccgctatccagtcagctgttgacctatatggggaaaattcaatggaa
gtaagtgctgttatgcaggcttatgatgcagttggagtagaataa

DBGET integrated database retrieval system