KEGG   Halomicronema hongdechloris: XM38_019930Help
Entry
XM38_019930       CDS       T04928                                 

Definition
(GenBank) peptide synthetase
Organism
hhg  Halomicronema hongdechloris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2125956..2131271)
Genome map
AA seq 1771 aa AA seqDB search
MSFSTLVDLLRRRALHQPGQKAFTFLKDGEIEAGSLTYRELDHQSRTIAARLQAMGLEGE
RALLLYPPGLEYLAAFFGCLYAGVIAVPAYPPRNQRNTPRILAVVKDAEAAIALTTTVIQ
ARLQSLLRKHEDLADLQWLTTDDLAAGAAGEWQPPTLGSDSLAFLQYTSGSTGMPKGVML
SHGNLLHNAAVTYELMGHSPESVFVSWLPVYHDMGLIGGILQPLYGDFPCILMPPASFLQ
RPYRWLQTISHYRGTTSGAPNFAYELCVEKVTPEQRQSLDLSSWTVAFNGAEPVRSQTLE
RFAAEFATCGFRSQAFYPCYGMAEATLMVSGGRQQEAPVVKLLQKVALEHNRVVEANGHS
VDQAQSLVGCGQTMPQQRIVIAHPETQIRCAGDEIGEIWVSGPSVGQGYWQRPAESEQTF
AAYLADTGVGPFLRTGDLGFLHQGELFITGRTKDLIIIRGRNLYPQDIELTTERSHPALR
SGGGAAFMVEEQREEKLVVVQELEFRQKPDPEEVTAAIREAIAQEHEVQAYAVVLIKPGT
IPKTSSGKIQRRATRAGFLAGHLEVISSSLLETTIPGEVPATLNRKTLLALPPIEAQLML
VSYLQALVAEVLQITPSQINSQQPISALGLDSLKAFELKNRLEVDLQVSVSISDLFDHLN
LTQLAIKILAQLELPEHLPSVPLVPVKAQRQHHPLSYPQKRLWFLDQLAPANPAYNIAFA
LQFQGPLSADILERSLNEVIRRHEPLRTTFKLVEGQPAQVITPSCWLPLKVVDCQNLSSE
ARESEVQRCATQASQQPFQLSQGPLMRAQLFHLAPQQHVLLLTLHHIIADEWSVEVLIRE
LLGNYKGFLSHGEIPALPAVSVQYKDFTHWQRQWLRGERMEGQLAYWIQHLEGAPAVLAL
PTDHPRPAVQTYQGARQSLALPHPLTEKLKALSEQENVTLFMVLLAAFKTLLYRYTGQDD
ILVGSPIANRSRSELKGLIGFFVNTLVLRTDLSGNPRFQELLGRVRQVALGAYAHQDVPF
NQLVEALQPERDVSHTPLFQVSFTLRQAPQLDTVPGLTVRPFEVDSKTAQFDLSLVVETT
EQGLTTLFEYNTDLFEAATITRMLGHWQQLLEGIVASPQTRLSDLPLLTEAERCQILKQW
NDTEVDYPRDLCIHQLFEAQVERTPDAVAVVFEQQQLTYRELNQRANQLAHYLQQLGVKP
EGLVGICVERSVEMVIGLLGILKAGGAYVPLDPAYPQERLAFILADAKVSVLLTQRELLE
ALPTEGAAVVGLDTNWEKIAQENLNNPVNQTDSKSLAYAIYTSGSTGKPKGTLIPHRGLI
NYLTWCVQAYEVEGGKGTIVHSSLAFDLTITGLFSPLLVGRQVTLIPEDQSVESLTNVLR
KESNLSLVKLTPAQLLLLTQQLLPKEAAGRTNAFIIGGENLLTENISFWQSFAPATMLVN
EYGPTETVVGCCVYRVPHGETQSSSVPIGQPIANTQLYVLDQYHQPVPIGVPGELYIGGA
GLGRGYLNQPELTAEKFVPNPFSDKPGTRLYKTGDLARYRSDGNLEFLGRIDHQVKVRGY
RIELGEIEGLLRQHPDIREAVVVKREDVPGDQRLVAYVVSNIGVETTTNSFRNFLKEKLP
EYMVPSVFIKLKALPLTTNGKIDRQALPVPDSTRPELEAAYVAPHSEIEQAIAKVWQEVL
HLEKVGINDNFFDLGGHSLLMAQVNHKLQELFNQDLSVVELFQNPTINSLAQYLSRESKQ
QPSFQSMRDRAQKQIEAINRQKQLLMKQGKR
NT seq 5316 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttccacactggtcgatctcttgcgccgtagggcactacatcagcctggccaa
aaggcgtttacctttctgaaggatggagaaatagaggctggttctctcacctatcgggaa
ctggatcaccagagtcgaaccatcgcggcgcggctgcaggccatggggctggagggagag
cgagccctgttgctgtatcccccaggcttggagtacttagcggccttttttggctgcctt
tacgccggagtcatcgcagtacctgcctatcctccccgcaatcagcgcaatactccccgg
attctggcggtggtcaaagatgcagaggccgcaatagcgctgacaaccacggtgattcaa
gccaggctgcagtcattattgcggaagcatgaagatttggccgatttacagtggctgacc
actgatgacctggctgcgggagctgcgggggagtggcagcctccgaccctagggtcagat
tccctggcgtttctccagtacacctccggttccaccggtatgcccaagggggtgatgctc
agccatggtaatttgctccacaatgcggctgtcacctacgagctcatgggtcattcgccg
gagagtgtgtttgtttcttggctaccggtttaccacgacatggggttgattggaggtatc
ttgcagccgctatacggagactttccctgcatcttgatgccgccggcttcattcctgcag
cgcccttaccgctggttacagacgatttctcactatcgaggcaccaccagcggggcacct
aactttgcctatgagctatgtgttgaaaaggtgacgccggagcagcggcaaagcttagac
ttaagcagttggaccgttgcctttaacggggcagagccggtgcggtctcaaacattagag
cgatttgccgccgagtttgccacctgtggatttcgttcccaggcgttttatccttgctac
ggcatggccgaagcaacgctgatggtctccggtgggcgtcagcaggaagcgcctgtggtg
aagttgctgcaaaaggttgccctggagcacaatcgcgtggtagaagccaatggccacagc
gtcgatcaagctcagtccctggttggttgtggccaaaccatgccccaacaacggattgtg
atcgcccatcctgagacacaaattcgctgcgctggcgatgagatcggtgaaatctgggta
tcggggccgagtgtgggccaaggctattggcagcggcctgcggagagtgagcagacattt
gctgcctatctggctgatacaggagtaggaccgtttctgcgcaccggtgatttgggcttc
ctgcaccagggagaactgtttattacggggcggactaaagacctaattattattcgcggt
cgtaatctttatcctcaggatattgaactgacgacggagcggagtcacccagccctgcgc
tcgggtgggggggccgcgtttatggtggaggagcagcgagaggagaagctggttgttgtt
caggaattggaatttcgacaaaaacccgatccggaggaagtgacggcagccattcgtgag
gccattgcccaggagcatgaggtacaagcctatgccgtcgtgttaattaaacccgggacg
attccaaaaacatcgagcgggaaaattcagcggcgagctacccgggcagggtttctggcc
ggccatctggaagtcatcagcagtagcctgctggaaacaacgatccctggggaagtccct
gctacgcttaaccgcaaaaccttactagcactaccaccgattgaagctcagctcatgctg
gtgtcttatttacaggcactggtcgccgaagtcctgcagataacgccatctcagataaat
tctcagcaacccatcagcgccttgggattggattctctgaaggcatttgaactgaaaaac
cgccttgaggttgatctccaggtctctgtatccattagtgatcttttcgaccatctgaat
ctgacccagttggccatcaagattttagcccaattggagttaccagagcatttgccatcg
gtgccattggtaccggtaaaagctcaacgccaacatcacccgctttcctacccccagaag
cgattatggttcctggaccaactagcgcccgccaacccagcttataacattgcctttgcc
ctgcaattccaaggtccattgagtgcagatatactggagcgcagtctgaatgaggttata
cgacgccatgagccattacgaacaacgtttaagttagttgagggtcaaccggctcaggta
attactccatcctgctggctaccactaaaggtagtagattgccagaatctctccagcgaa
gcgcgcgagtctgaagtacaaagatgcgcgactcaagctagccaacagcctttccaattg
agccagggaccactaatgcgggcacaactctttcacctagctccacagcagcatgtgctg
ttgctgacgctgcatcacatcatcgccgatgaatggtcagtcgaggtattgatccgggag
ttgttagggaactacaagggatttctgtcgcatggggaaatccctgctcttccagccgtc
tctgtgcagtacaaagactttacccattggcagcggcaatggcttcgcggtgagcgcatg
gagggtcagcttgcttactggatacagcatcttgagggagcgccagcagttctagcgttg
ccaacggatcatccccggccggcggtccagacctatcaaggggcgcgacaatccttggcg
ctgcctcaccccttgactgagaagctcaaggctctctctgagcaagaaaatgtcaccctc
ttcatggtgctgctggcagcattcaagacattgctctatcgctatactggtcaagacgat
attctggtgggctcaccgattgctaatcgcagccggagcgagctcaaggggttaattggc
tttttcgtgaatacattggtgttgcgcaccgatctgtcaggtaatcccaggtttcaggag
ctactcggccgagtccgtcaagtagccttgggggcctatgcccatcaagatgtgcccttc
aatcagctggtagaggccttgcagccagagcgagacgtgagtcatactcccctgtttcag
gtgtcgttcacactgcggcaggctccacagttggacacggtaccgggtttgactgtgagg
ccatttgaagtggatagcaagacagctcagtttgatttgagtctggtggtggaaacgacg
gagcagggactcactaccttgtttgagtacaatacagatttatttgaggctgccaccatt
acccggatgctagggcattggcagcagttgctggaggggattgtcgccagtccacaaact
aggctctcagacttaccgctgctgacagaggcagagcgctgccaaatactcaaacaatgg
aacgatacagaggtcgattatccccgagatttgtgcatccatcagctgtttgaagcccag
gtggagcgaactcccgatgccgtggcggtagtttttgagcagcagcaactgacttaccgg
gagttaaatcagcgggcaaatcagttggcccattatctgcaacagttaggagttaaacca
gaggggttagtcggcatttgtgtggaacgttccgtggagatggttatagggctgcttggc
attcttaaggcaggtggagcctacgtgccgctggatccagcctatccgcaagagcgtttg
gcttttatattggcagatgccaaggtatcagtattgttaactcagcgagagttgctagag
gcattgccaactgaaggagctgcagtggttggcttagacaccaactgggaaaaaattgct
caagaaaatttaaataatccagtcaaccagacagattctaaaagtttagcttatgctatt
tacacatcgggttctaccggcaaacccaagggaactttaattccccatcgaggtctaatt
aattacttgacttggtgtgtccaagcttatgaagttgagggaggaaaaggaactattgtt
cattcttctctagccttcgacttaacgattacagggttgttttcccctttactagttggg
cgtcaggtaacgcttatccctgaagatcagagtgttgagtctttgactaatgttcttcgt
aaagagtcaaacttaagtcttgttaaattaacaccagctcaactgctattacttactcag
cagttgttgccaaaagaagcggcaggcagaactaatgcgtttatcattggtggtgaaaac
ctgctgacagaaaatatttctttctggcaaagcttcgcacctgctacgatgctggtaaat
gaatatggaccaacagagacggtcgtgggatgttgtgtttatcgagtgccccatggtgaa
actcaatcaagctcagttcccattggtcagccgattgctaatactcagctttatgtatta
gaccaatatcaccaaccagtaccgattggggtcccgggcgaactgtatatcggtggtgct
ggactggggcgtggttatctgaatcagccagaactgacagctgagaagtttgttcctaat
ccatttagtgataagccagggacaaggttatacaagacgggggatctggctcgttatcgg
tcagatggaaatcttgagttcttgggacggattgaccatcaggtgaaggtgcggggatac
cgaattgaactaggagaaattgaagggttgctgaggcagcatccagacattcgagaagca
gtagttgtgaagagggaggatgtaccgggagatcagcgtttggtggcttatgttgtttcc
aatattggggtagaaactaccaccaatagtttcaggaactttcttaaagagaaactgccg
gagtatatggtaccgtcggtatttataaaattgaaggcgctgccattgacaactaacggc
aagatagatcgtcaggctttaccagtacctgatagcactcgtccagagctagaagctgct
tatgtggctcctcattctgaaatagagcaggcaatcgctaaggtctggcaagaagtgttg
cacttggagaaggtaggtatcaatgataatttctttgaccttggaggtcattctctgttg
atggctcaggtaaatcacaaattacaagaattgttcaaccaggatttatcggttgttgag
ttgtttcaaaatccaaccattaattccttggcgcagtatttgagtcgcgagtcaaagcag
cagccttctttccaatcaatgcgtgaccgtgctcaaaagcagatagaggcaatcaatcgg
caaaaacagttattgatgaagcaaggaaaaagataa

DBGET integrated database retrieval system