KEGG   Halomonas hydrothermalis: CLM76_17925Help
Entry
CLM76_17925       CDS       T05117                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
hhh  Halomonas hydrothermalis
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLM76_17925
   00620 Pyruvate metabolism
    CLM76_17925
   00630 Glyoxylate and dicarboxylate metabolism
    CLM76_17925
  Energy metabolism
   00680 Methane metabolism
    CLM76_17925
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLM76_17925
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CLM76_17925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3858925..3859899)
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGGAGQISYSLIFRIAAGDMLGPDQPVILQLLEIPQAMGALNGVVMEVNDC
AFPLVQDIVATDDPNVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVKVLVVGNPANTNALIASCNAPDLDAGQFTAMTRLDHNRALTQLAQKTGKHVTDVEN
MIIWGNHSATQYPDLAQCKVDGKAAFDLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHMRDWALGCDGIVSMAIPSDGSYGIAEGIIYSYPVRCQGGKYEIVQGFELDAF
SKEKMQATEKELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatccagtacgtattgcgattaccggcggtgccggccagatcagctactctctt
attttccgcattgccgctggcgacatgctggggccggatcagcccgtcattctccagctt
ctcgaaattccccaagccatgggcgcgctgaacggcgtggtcatggaagtgaacgactgt
gcgttcccgctggtgcaagatatcgtcgccaccgacgatcccaacgtggcgttcaaggat
gccgacttcgctctgctggtaggtgctcgtccgcgtggccccggcatggagcgtaaagac
ctgctggaagccaacgccgccatcttctccgtacaaggtaaagcgctgaacgaccacgcc
agccgcgacgtgaaagtgctggtcgtcggcaacccggccaacaccaacgcgctgatcgcc
tcctgcaacgcgccggacctggacgctggccagttcaccgccatgacccgtctggaccac
aaccgcgccctgacgcagctggcacagaagaccggcaagcacgtcaccgacgtcgaaaac
atgatcatctggggcaaccacagtgccacccagtacccggacctggcccagtgcaaggta
gacggcaaagccgctttcgatctggtcgagcgcgactggtacgaaaacgacttcatcccg
accgtacagcagcgcggtgccgccatcatcaaggcgcgcggcgcctcgtctgccgcctct
gctgcgtcttccgccatcgaccacatgcgtgattgggcgctgggctgcgacggtatcgtc
agcatggccatcccctccgacggcagctacggcatcgccgaaggcatcatctactcctac
ccggtgcgctgccagggtggcaagtacgaaatcgtacaaggtttcgaactcgatgcgttc
agcaaagagaagatgcaggccacggaaaaagaactgcgtgaagagcgcgctgccgtcgag
cacctgctcggctaa

DBGET integrated database retrieval system