KEGG   Haloarcula hispanica N601: HISP_01545Help
Entry
HISP_01545        CDS       T02949                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19588  
2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
hhn  Haloarcula hispanica N601
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:hhn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HISP_01545
   00053 Ascorbate and aldarate metabolism
    HISP_01545
Enzymes [BR:hhn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     HISP_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(288202..289647)
Genome map
AA seq 481 aa AA seqDB search
MTQTYENYIGGEWTGSGETQDVTNPADETDVVSTVPVASAADADEAVAAAAEATDEWGGM
SGPERGVLLRETGEILKSRKDELAETLTREEGKPLGEAEGEVQRAIDIFYYYAEKARDFG
GTVKQPSGGRAGLQTKKEPMGVAALITPWNYPIAIPAWKIAPALAVGNTVVIKPAMQAPT
VGAMIVEALDEAGIPDGAINLVCGPGSEVGERLTTHEDVDVVSFTGSAAVGEHVYEQATS
NGKRAQAEMGGKNPTVVMPSADVDKAADIVGAGAFGGTGQACTATSRAIVHEDVYDEFLD
AVVDYAESLEIGNGLDRAGMGPHVSEDELAGSLEYIDIAQSEGATLETGGEELAGGEYDA
GNFISPAVFSDVEPDMRIAQEEVFGPVLAVIPVSDFDEGVEVANDIDYGLSASIVTDRIE
EENEFIERSESGVVKVNEKTTGLELHVPFGGLKRSSTNTYREQGDAGLEFFSYIKTVYRN
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgtatgagaactatatcggcggtgagtggaccgggagcggagagacacag
gacgtcacgaacccggcagacgagactgacgtcgtcagcacggttccggtggcctcggcg
gcggacgccgacgaagcggtcgcggccgcggcggaagcaacagacgaatggggcggaatg
tctggcccggagcgcggcgtgctcctgcgtgagaccggtgaaatcctgaagtcccggaaa
gacgagcttgcggagacgctgacccgcgaagaggggaaaccgctcggcgaagccgagggc
gaggtacagcgtgcgattgatatcttctattactacgcggagaaggcccgcgacttcggc
ggcactgtcaaacagccaagcggcggccgcgccggtctgcagacgaaaaaagagccgatg
ggcgtcgcggcgcttatcacgccgtggaactaccccatcgcgattccggcctggaagatc
gccccggcgcttgcggtcggcaacaccgtcgtcatcaagcccgcgatgcaggcgccgacc
gtcggcgcaatgatcgtcgaggcgcttgacgaggccggtattccggacggcgctatcaac
ctggtctgtggccccgggagcgaggtcggcgagcgactgaccacccacgaggatgtcgac
gtagtgtcgttcaccggcagcgcggccgtcggcgagcacgtctacgaacaggcgacaagc
aacgggaagcgcgcgcaggcagagatgggcgggaagaacccgaccgttgtcatgccgagc
gccgacgtggacaaagcggccgacatcgtcggagcaggggccttcggcgggacgggccag
gcctgtacggccacgtcccgggccatcgtccacgaggacgtgtacgacgagttcctcgac
gccgtcgtcgactatgcagagtcgctcgagatcggaaacggcctcgaccgggccggcatg
ggtccccacgtcagtgaggatgagctcgcggggagcctggagtacatcgacatcgcacag
tcggagggagcaaccctcgaaacgggcggcgaagagctcgctggtggcgagtacgacgcc
gggaacttcatctcgccggccgtcttctccgacgtcgaacctgacatgcgcatcgcacag
gaagaggtgttcgggccggtgctcgccgtgattcctgtctccgacttcgacgaaggtgtc
gaggtcgccaacgacatcgactacgggctctcggccagcatcgtgaccgaccgaatcgag
gaggaaaacgagttcatcgagcgctccgagtctggtgtggtcaaggtcaacgagaagacg
accggactggaactgcacgttcccttcggcggcctcaagcgctcctcgacgaacacctac
cgcgagcagggcgacgccgggctggagttcttcagctacatcaagacggtgtaccgcaac
agctaa

DBGET integrated database retrieval system