KEGG   Haloarcula hispanica N601: HISP_12640Help
Entry
HISP_12640        CDS       T02949                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00010  Glycolysis / Gluconeogenesis
hhn00053  Ascorbate and aldarate metabolism
hhn00071  Fatty acid degradation
hhn00280  Valine, leucine and isoleucine degradation
hhn00310  Lysine degradation
hhn00330  Arginine and proline metabolism
hhn00340  Histidine metabolism
hhn00380  Tryptophan metabolism
hhn00410  beta-Alanine metabolism
hhn00561  Glycerolipid metabolism
hhn00620  Pyruvate metabolism
hhn00625  Chloroalkane and chloroalkene degradation
hhn01100  Metabolic pathways
hhn01110  Biosynthesis of secondary metabolites
hhn01120  Microbial metabolism in diverse environments
hhn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HISP_12640
   00053 Ascorbate and aldarate metabolism
    HISP_12640
   00620 Pyruvate metabolism
    HISP_12640
  Lipid metabolism
   00071 Fatty acid degradation
    HISP_12640
   00561 Glycerolipid metabolism
    HISP_12640
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HISP_12640
   00310 Lysine degradation
    HISP_12640
   00330 Arginine and proline metabolism
    HISP_12640
   00340 Histidine metabolism
    HISP_12640
   00380 Tryptophan metabolism
    HISP_12640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HISP_12640
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HISP_12640
Enzymes [BR:hhn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HISP_12640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHB66814
UniProt: V5TQE2
LinkDB All DBs
Position
1:2418641..2420110
Genome map
AA seq 489 aa AA seqDB search
MSQPDSQTAWSQLYIDGEWRDAGASDTIPVTNPATGEEIAAVPAGTEGDVNDAYQAAEAA
QSDWAALSREERNEYVQAMIGIMQERLDEIVELLATESGSVQAKATAEANFAMADFQSAL
EMVPPEEEVRDSMYHEDKDHHIVREPAGVVGIISPWNFPLHLTTRALGPALALGNTVVIK
PATDTPITGGLLLADIAEEAGLPDGVVNVVTGHGSDIGDRMAGHPTARVMSFTGSTAVGR
SVASQAGDALALPALELGGNGPFVVTEDADIEAAAKAGSVGAFGHQGQVCISINRHLVHE
DVYDEYVEKLVEHAESLTIGNPLDEDVEFGPIINESQVDQLTSFIEQTVDAGATLETGGE
VEDLFLEPTVLSGCTNDMSAACNEHFGPVAPVIPFESDEEAVELANDTEYGLAAGVYSGD
VEHGRSIADQIDAGMVHVNDHPIQDEPNAPFGGMKNSGLGRYNGEWIMDELTETKWISVQ
HEERDYQLL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaccagatagccagacggcgtggagccaactgtacatcgacggcgagtggcgc
gacgccggagcgtctgatacgattccggtgactaaccccgcgacgggcgaggaaatcgcg
gcggtgcccgccgggacagagggggacgtcaacgacgcctatcaggccgccgaagcggcc
cagtccgactgggcggcgctgtcgcgcgaggaacgcaacgagtacgttcaggcgatgatc
gggataatgcaggaacgactcgacgagatcgtcgaactgctcgcgacggagtcgggcagt
gttcaggccaaagcgactgccgaggccaacttcgccatggcggacttccagagcgcactg
gaaatggtcccgccggaggaagaggtccgcgattcgatgtatcacgaagataaggaccat
cacatcgtccgcgagcccgctggcgtcgtcgggattatttcgccgtggaacttcccgcta
cacctcacgacgcgggcgctcggtcccgcgctcgcactggggaacaccgtcgtcatcaag
cccgcgacggacacgccgattaccggcgggctcctgctggccgacattgccgaggaagcc
ggtctcccggacggcgtcgtcaacgtcgtcacgggccacggctccgacatcggcgaccgg
atggccggccatccgaccgcccgcgtgatgtcgttcaccgggtcgacggcggtcggcagg
tctgtggccagtcaggccggggacgcgctcgccctcccggcgcttgaactcggtggcaac
ggaccgttcgtcgtcaccgaggacgccgacatcgaggcagccgccaaggccggctccgtc
ggtgccttcggccatcagggacaggtgtgtatctcgattaaccgccacctcgtccacgag
gatgtctacgatgagtacgtcgagaagctcgtcgaacacgcggagtcactgactatcggg
aacccgctggacgaggacgtggagttcggcccgatcatcaacgagagtcaggtcgaccag
cttacctcgttcatcgaacagactgtcgatgccggcgcgacgctggaaacgggcggcgag
gtcgaggacctgttcctcgaaccgaccgtcctctcggggtgtaccaacgatatgtccgcg
gcctgtaacgagcacttcggccccgtcgctccggtcatcccgttcgagtccgacgaggaa
gctgtcgaactcgccaacgacaccgagtacggcctcgccgcgggcgtctacagcggtgat
gtcgaacacggtcgttccatcgccgaccagatcgacgccgggatggtccacgtcaacgac
cacccgattcaggacgaacccaacgccccgttcggcgggatgaaaaactccggcctcggc
cggtacaacggcgagtggatcatggacgaactgaccgagaccaagtggatctccgtccag
cacgaagagcgcgactaccagctgctgtaa

DBGET integrated database retrieval system