KEGG   Haloarchaeon HSR6: HSR6_1136Help
Entry
HSR6_1136         CDS       T04550                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hhsr  Haloarchaeon HSR6
Brite
Enzymes [BR:hhsr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HSR6_1136 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1074505..1075119
Genome map
AA seq 204 aa AA seqDB search
MSERSHPELPELPYDYDALEPHISEQVLEWHHDTHHQGYVNGLDSAEEALAEARETGETH
GTQAALRSVSHNGSGHYLHTMFWDNMSPNGGGEPEGALRERIEEDFGSYEAWRQEFEEAA
GYSAGGWALLVYDPVAKQLRNLAVQKHNDGALWGAHPILALDVWEHSYYFDYGPARGEFV
DAFFEVIDWDDVAENFEKVSSRVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgttcgcaccccgaactgccggagttgccttacgactatgatgccctcgaa
ccacatatctccgaacaggtactcgagtggcaccacgatacccaccatcagggctatgtc
aacggcctggacagcgccgaggaggccctggccgaggcccgcgaaactggagagacccac
ggcacgcaggcggccctccgatcggtgagccacaacggctcgggccactatctccacacc
atgttctgggacaacatgtctccgaacggcggtggagagcccgagggcgcactgcgagag
cgtatcgaggaggacttcggctcgtatgaggcctggcgacaggaattcgaagaagcagcc
gggtattcagccggtggctgggcgctactggtctatgatccagtcgcaaaacagctccgc
aacctggccgtccagaagcacaacgacggtgcgctatggggcgcacaccccatcctggcc
ctcgacgtgtgggagcactcctactacttcgactacggccccgcccgcggcgagttcgtc
gatgccttcttcgaagtaatcgactgggacgacgtcgccgagaacttcgagaaggtcagc
tcccgggtcgagtaa

DBGET integrated database retrieval system