KEGG   Haliscomenobacter hydrossis: Halhy_5666Help
Entry
Halhy_5666        CDS       T01491                                 

Definition
(GenBank) Catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Halhy_5666
  Amino acid metabolism
   00380 Tryptophan metabolism
    Halhy_5666
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Halhy_5666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7232026..7234197
Genome map
AA seq 723 aa AA seqDB search
MKDSNPSIKDSNTAKIDDLAQNTENGQGEFLTTNHGLRINDDQNSLKAGERGATLLEDFQ
LREKITHFDHERIPERIVHARGSGAHGYFELHESMTPYTKAKFLQTPGTQTPVFVRFSTV
AGSRGSTDLARDVRGFSVKFYTEEGNYDLVGNNVPVFFIQDAMKFPDLIHAVKPEPHHEM
PQAGSAHDTFWDFVSLMPESMHMIMWAMSDRALPRSLRMMEGFGVHTFRLVNENNESVFV
KFHWKPVLGVHAVSWDEAQKISGKDSDFHRRDLWEAIDSGNFPEWNFGVQIVPESDEHKF
EFDLLDPTKLIPEELVPVQIIGKMVLNRNPDNFFAETEQVAFHPGHIVSGIDFSNDPLLQ
GRLFSYTDTQLSRLGSPNFHEIPINRPIAPVHNNQRDGHMRQTINTGQSSYHPNKVGNGC
PFQAKASEGGFVAYNKRIDARKIRARSPSFFDHFSQATLFFNSQSEVEKNHIVAALQFEL
GKLETEAIRLRIVYMLTQVDESLAARVAKGLGIAVPPAPELPLNQSIPADGDPEKFQPTP
MVSSIKMSKALSMAGTVKDNIKTRQIAILATDGVDKVSLLTMKQVLEDAGAQTKIIAPHL
GFITPNNGNPIKVDQSFLTAASVLFDAVYVPDGQQSSAALAQEQDAIHFINEAYKHCKAI
AADGAGVKLIDATAAGVKIHSAGKADKSSLALGVVLNGEATEFVSAIAQHRFWEREKSGK
VPA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagactccaatccatccataaaagattccaatacagcaaaaattgacgacctggct
caaaacacggagaacgggcagggtgaattccttacgaccaatcatggactgcggattaat
gatgatcaaaactccttaaaagccggagagcggggggcaaccctgctggaggacttccaa
ttgcgggaaaaaataactcattttgatcatgagcgcattccggaacgcatcgtacatgcc
cggggaagtggagcgcacggatacttcgagctgcatgaatccatgaccccatacaccaaa
gctaaattcttgcaaactcccggtacacaaaccccggtatttgttcgattcagtacagta
gcaggttcacgtggctcaaccgatttggcgcgggatgtcaggggcttttccgttaagttt
tataccgaagaaggcaactacgatttggtggggaacaacgtacccgtgttctttatccag
gacgccatgaagtttcccgatcttatccacgccgtcaagccggagccgcaccacgaaatg
ccgcaagccggatcggcgcacgatactttttgggattttgtttcgctgatgcccgagagc
atgcacatgatcatgtgggccatgagtgaccgtgccctaccgcgcagtttgcgcatgatg
gaaggctttggggtacacaccttccgcctggtcaatgaaaacaatgaatccgtttttgta
aaatttcactggaaacccgtattgggcgtacacgcggtgtcctgggacgaagcccaaaaa
atatccgggaaggattccgattttcaccgcagagatttatgggaagccattgattcgggt
aattttccggaatggaattttggggtacagattgtaccggaaagtgacgagcataaattt
gaattcgacttgcttgatcccaccaaactcattcccgaggaacttgttccggtacaaatc
attggcaaaatggtcttgaaccgcaaccccgacaacttctttgccgaaaccgagcaggtg
gcttttcacccggggcacattgtgtcgggcattgatttcagcaacgatcccttgttgcaa
ggacgtttgttttcttacaccgacacccaactgagccgcttgggaagccctaattttcac
gaaatacccatcaaccgtcccattgccccggtacacaacaaccaacgcgacggccacatg
cgccaaaccatcaacaccggtcaatccagctaccatccgaataaggtaggaaatggctgc
ccctttcaggccaaggccagtgaaggcggatttgttgcctacaataaacggattgatgcc
cgaaaaatccgcgcacgcagccccagcttttttgaccatttcagccaggccaccttgttt
ttcaacagccaaagcgaggtggagaaaaaccacattgttgccgcattacagtttgaattg
ggcaaactggaaaccgaggcaatccgactacgcatcgtatacatgctgacgcaggtggat
gaatccctggcggcaagggtggccaagggattgggtatcgcagtaccccccgcgccagaa
ctgcccctcaaccagagtattcccgccgatggagaccccgaaaaatttcaacctacacca
atggtttcttccataaaaatgtccaaggcactgagcatggcgggcacagtaaaggacaac
atcaaaacccggcagatcgccatactggctaccgatggtgttgacaaagtttctttgctt
accatgaaacaagtgctggaagatgccggtgcccaaaccaaaatcatcgcgccccacttg
ggttttattacccccaataacggcaacccgatcaaagtagatcaaagttttttgacggca
gcctcggttttatttgacgcggtatacgtaccagatggtcaacagagcagtgcggcactg
gcgcaagaacaagatgccatccattttatcaacgaagcgtacaagcactgtaaagcaatc
gctgcggatggagcaggggtaaaattgatcgatgctactgctgctggagtaaaaatacac
agcgctggcaaagcggataaaagttcgcttgcactgggcgtagtgctgaatggcgaagcc
actgaatttgtcagtgccatcgcgcaacaccgtttctgggaacgcgaaaaatcaggtaaa
gttccagcgtaa

DBGET integrated database retrieval system