KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_07650Help
Entry
HICON_07650       CDS       T01400                                 

Definition
(GenBank) Translation elongation factor
  KO
K02358  
elongation factor Tu
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Brite
Translation factors [BR:hil03012]
 Eukaryotic Type
  Elongation factors
   HICON_07650
 Prokaryotic Type
   HICON_07650
Mitochondrial biogenesis [BR:hil03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HICON_07650
Exosome [BR:hil04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HICON_07650
  Exosomal proteins of breast cancer cells
   HICON_07650
  Exosomal proteins of colorectal cancer cells
   HICON_07650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(538712..539896)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELAGHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacattac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacatgttgaatatgatacaccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggcacaaatggat
ggtgctattttagtcgtagcagcaacagatggtccaatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttctgcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatcctagaattagcgggtcacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagacgtgttctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaacgggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtacaaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactgga
actattgaattaccagaaggcgtggaaatggtaatgccaggcgataacatcaagatgaca
gtaagcttaatccacccaattgcgatggatcaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgctggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system