KEGG   Heterobasidion irregulare: HETIRDRAFT_155921Help
Entry
HETIRDRAFT_155921 CDS       T03455                                 

Definition
(RefSeq) animal heme peroxidase
Organism
hir  Heterobasidion irregulare
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 20667603
NCBI-ProteinID: XP_009549061
JGI: Hetan2_155921
UniProt: W4K086
LinkDB All DBs
Position
Unknown
AA seq 1067 aa AA seqDB search
MASRLVQRASTFGVPKPEAPNNGDHDQSDGIPKVIRDFREQIKKGLPTYYEPSTLAALVD
AIGNLNSLDDRKMLLEHILTILSHMPEGPVLKRLENLVIEFLYNDLSHPPATYLGDKYAW
RNADGSHNNLSDPSMGKAGTPYARSVQQTHALPRNNLPDAGLVFDTLLKREGFVKHPAGL
SSMMFSFAALVIHTVFRTSHKDVNVNETSSYVDLSPLYGHDEKSLNKIRVRDGRGLLYPD
TFAEDRLLLLPPAVCVLLVLFSRNHNYIARKLLEINERGTYVDPDIPSNDPDRSKKLLKQ
EDEIFNTARLVNCAWFGAAIFADYFSSILGLVRQGSSWSLNPFGEIREEDHKLFERGKGN
VCSVEFNCLYRWHATTSVEDEKWVEQLMAHIFENKPVDQLTIDDFKTATKKIQAEEPDIT
HWTFGNLKRQADNTFRDEELAAILKNATEHPASAFKARGTPQVMKLHEIMGIESNRRWGV
CSLNEFRQFLGLKPYTSFLEWNPNPEIADAAEKLYGDIENLELYVGLQAEEAKPVVDGAG
LCPGYTISRAILSDAIALTRGDRFFTADFTPFNMTAWGFADCQRDPHGPGNGSMLGRLLL
RALPGEYSQNSTYTWFPLQTPESMKGFLKNLGTADKFDFQRPGDPGPIANANEYRDVEQV
LKSENFNTPGSEKISEIVKGEGFDAAQGRREQREVLRALTSSPNALDKIAQSFYDNTRTL
MSSKSYTLTDKNTRNVDIVRDVLKYVPLRWAATEIAGLQLKTDKHSFGTYTEAELYGMLT
DIYTLFFLDVDPSKAMNLELKVQEHVSELKRHIKAGLIGSAGGRLSIASFVGTIQQLFSS
TKAKKSTRVPFAHTLFERGGTVDEVTNNILALLIGTTVELSQTLTNVVNFYLNDKNPPPL
INAEDPKNEAVLQGYVHEAMRIDPAFRGVYRESTIDQSIGSLSLKAGQRVFVNIASANLD
GDVFASPKTVDITRSPKEMYLTGDGAARCLGDELRTKVIAQVLKAVTEFDGLIRGPGSSG
KLKRYKTVADNTLRYEYLGSDNLPTAWATSMTVQYTVSQNGSGANTA
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagacttgtgcagagagcttcgacgttcggagtacctaagcctgaagcgccc
aacaacggcgaccacgatcagtccgatggcatccccaaagtcattcgcgatttccgcgaa
cagatcaagaaggggctgccgacatactacgagccatcgactctcgctgctttggtagac
gcgatcggcaaccttaactctctagacgatcgcaaaatgctgcttgagcacatcctgacc
atcttgtctcacatgccggagggccctgtcctcaagaggctggagaaccttgtgatcgag
ttcctctataatgatctgtctcatcctccggctacgtaccttggagacaagtacgcgtgg
agaaatgcagatggatctcataacaacctcagcgatcccagcatgggcaaggccggaacc
ccctacgctcgtagtgttcaacagacacacgcattgccccggaacaatctgccagatgct
ggcctcgtctttgatactttgctaaagcgggaagggtttgtcaaacatccagcaggatta
tcaagcatgatgttctcctttgcggcattggtcattcatacggtctttcgcacttctcac
aaagatgtcaacgtcaatgagacctcatcctacgttgacttgtccccactttatggtcac
gatgagaaatcattgaacaaaatccgcgtgagagacgggcgcggtctcctgtatcccgac
acattcgcagaagacaggcttctcctgctcccacctgccgtttgtgtcttgttggttctg
tttagtcgcaaccacaattatatcgcgaggaagctgctcgagatcaacgagcgcggaacc
tatgtcgaccccgatatcccatcaaacgatcccgacaggtcgaagaaattactaaagcaa
gaggatgagattttcaacactgcgcgtcttgtgaactgtgcttggttcggtgcggccatc
ttcgcagactatttcagtagtatcttgggcctagtgaggcagggcagttcatggagcctc
aatccatttggagaaataagagaggaggaccacaaactgttcgagcgtggtaagggtaac
gtctgcagtgtcgagttcaattgcctctaccgatggcatgcgaccacgtctgtcgaagat
gaaaaatgggtcgaacagctgatggcgcatatcttcgagaacaagcctgtcgaccagttg
accatcgatgacttcaaaacagcgacgaagaagatacaggcggaggaacctgacatcacg
cactggacgtttggaaacctgaaacggcaagcggataatacctttagggatgaggaattg
gcagccattttgaagaatgctacggagcacccagcgtctgcgttcaaggcgcgaggcaca
cctcaagttatgaagctgcatgaaatcatgggcatcgagtcgaatcgtcggtggggtgta
tgttctttgaatgaattcagacagttccttggcctgaagccatacaccagtttcttggag
tggaatccaaaccctgagattgcagacgctgcagagaagctgtacggagatatcgagaac
ctcgagctttatgttggacttcaggctgaagaggccaagcccgtcgtggacggtgctggt
ctttgtccagggtacaccattagcagagctatcctcagcgacgcaattgcccttactaga
ggcgaccgcttcttcactgcggacttcacgcctttcaatatgactgcctggggtttcgca
gactgccagcgagaccctcatgggcctggaaacgggagcatgctcgggcgtcttctactc
cgtgcgctccctggagagtactcgcagaatagcacctacacttggttcccgctccagaca
ccagaatccatgaagggattcttgaaaaatttgggcacagcggacaagttcgacttccag
aggcctggtgacccgggaccgatcgctaatgcaaatgagtatcgagacgttgagcaggtg
ctgaagagcgaaaacttcaatacgcccgggtcggaaaagatttctgagattgtcaagggc
gaagggttcgatgccgcgcagggtagacgcgaacagcgtgaggtgttgcgggccctgact
tcgtcgcccaatgcgctggacaagattgcgcagtccttctatgataacacgcgtaccttg
atgtcgtcgaagtcctacaccttgacggacaagaacacgaggaatgttgacatcgttcgg
gatgtactcaagtatgttccgctccgctgggccgctaccgagatcgctggattgcagctc
aagactgacaaacattctttcggcacatataccgaggctgagctctatggaatgctgact
gacatctacacgctgttcttcctcgatgttgacccttcgaaagccatgaaccttgagctg
aaagttcaagagcatgtcagcgagctcaagcggcacatcaaagctggcctgataggcagc
gctggtggaaggctgtcgatcgcctccttcgtgggtactatccaacagctattttcatcg
accaaggcaaagaagagcactcgggtgccgtttgcgcataccctctttgaacgaggcggc
accgtcgacgaagtgacgaacaacatcctcgcgctcctcatcgggaccacagtcgagctg
tctcagaccctcaccaacgttgtcaacttctacttgaacgataagaacccgccgccgttg
atcaatgccgaggatccgaagaacgaggcggtgctgcaaggatatgtgcatgaggctatg
agaatcgatcctgccttccgaggtgtctaccgtgaatccacgatcgaccaaagcatcggt
agcctctcgctcaaagcgggtcagcgggtctttgtcaacatcgcgagcgccaacttggac
ggcgatgtttttgctagtcctaaaactgtggacatcacccggagccccaaagagatgtat
ttgaccggagacggtgcagctaggtgtttgggtgatgagctcaggactaaagtcatcgct
caggtacttaaggctgtgactgagttcgacggtctcattcgcggccccggctcgtctggc
aagctgaaaagatacaagactgtggctgataataccctgcgctacgagtacctcgggtct
gacaacttgcctacggcgtgggctacctcgatgactgttcagtacaccgtctcgcagaac
ggttctggtgcgaacactgcttga

DBGET integrated database retrieval system