KEGG   Heterobasidion irregulare: HETIRDRAFT_389219Help
Entry
HETIRDRAFT_389219 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
hir  Heterobasidion irregulare
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HETIRDRAFT_389219
   00051 Fructose and mannose metabolism
    HETIRDRAFT_389219
   00052 Galactose metabolism
    HETIRDRAFT_389219
   00500 Starch and sucrose metabolism
    HETIRDRAFT_389219
   00520 Amino sugar and nucleotide sugar metabolism
    HETIRDRAFT_389219
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HETIRDRAFT_389219
Enzymes [BR:hir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     HETIRDRAFT_389219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MPASRRGSGSVTLPTGQVLAIHTRTQDEEDLPHATKKTMADHLRKYESLFTLTPQRMRMI
VEAFKDTLEIGLEKPGQTVPMIPTFVFGWPTGTETGDYLALDLGGTNLRVCLVTLQGEGK
FEITQSKYRLTEEQKQEDGQKLFDFCAECLKTFVTTNLDEGTIKEGERLPLGFTFSYPCT
QERIDQGVLIRWTKGFGAADTEGHDVAEMFKRSLEKHDVPVELTALINDTTGTLIASHYV
NPRTKIAVIFGTGCNAAYMERIGGIPKIKNLGCDDDDEMAINCEWGAFDSFEHEHLPRTK
YDLTIDESSNKPGEQAFEKLISGRYLGEILRLVICELIDDGVLFLGQNTYKIEIAYALDT
AFLSLMESDPTEELLMIIGIFSHFFALETTLAERQFFRALAKLVGRRAARLSACGIAAIV
SKMGYLEEGCSVGADGSLYNKYPGFADRVHEGLQDIFGDKGRNIITHHAEDGSGVGSAII
AAMTKIRKDKGQYLHV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccagcatctcgcagaggaagtggtagcgtcaccttgcccaccgggcaggtactggcg
atccataccagaactcaggatgaggaggatctccctcatgcgaccaagaagactatggca
gatcaccttcgcaaatatgagagcttgttcactctcaccccgcagaggatgcggatgatt
gttgaggcattcaaggatactttggaaatcggcctggagaaaccgggtcagaccgtcccc
atgatcccaacctttgtcttcggctggcccaccggcacggaaaccggagattaccttgct
cttgacctcggcggaacgaatctccgtgtctgtcttgtcactctccagggcgagggaaaa
ttcgagattacgcagtcaaaataccgtcttaccgaggagcagaaacaggaagacggacaa
aagcttttcgatttttgcgcggaatgcctgaagacgtttgtcacgaccaacttggatgag
gggaccatcaaagagggagagcgcttgcctcttggatttacgttctcgtatccgtgcacc
caggaacgcatcgaccaaggtgttcttattcgttggaccaaaggctttggagccgccgat
acggaaggccacgatgtcgcagagatgtttaagagaagtctagagaagcatgacgtacct
gtagagttgaccgctctcatcaacgatacgactggcacgctcattgcctcacactacgtc
aacccacgcacgaagatcgccgtgatcttcggaactgggtgcaatgcggcctatatggag
cgtattggtggcatccctaaaatcaagaatttaggatgcgacgacgatgacgaaatggcc
atcaattgtgaatggggcgcgttcgattcgttcgaacatgagcacctgccaaggacaaag
tatgatttgacgatcgacgagagctcaaacaagccgggtgagcaggcttttgagaaattg
atctcaggtcgttaccttggcgagattctgcgtctcgtcatctgcgagctcatcgatgac
ggcgttcttttccttggccaaaacacatacaaaattgagatagcctatgccttggacact
gcgttcctctcgctaatggaaagtgacccgacagaggagcttctcatgatcatagggata
ttctcccatttcttcgccctcgagacgacgcttgctgagcgccagttcttccgtgctttg
gcaaagctggtcgggcgccgtgccgcacggctaagcgcgtgtggtatcgcagctatcgtg
agcaaaatgggatacctggaggaaggctgctcagtcggtgccgatggctcgttgtacaac
aaataccctggcttcgcggatcgggtccacgaggggttgcaggatatctttggggacaaa
ggacggaacatcatcacgcaccacgctgaggatggcagcggtgtaggaagtgccatcatt
gcagcaatgacaaagatcagaaaagacaagggacagtatctgcatgtctag

DBGET integrated database retrieval system