KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0748Help
Entry
NTHI0748          CDS       T00248                                 

Gene name
tufB2
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Brite
Translation factors [BR:hit03012]
 Eukaryotic Type
  Elongation factors
   NTHI0748 (tufB2)
 Prokaryotic Type
   NTHI0748 (tufB2)
Mitochondrial biogenesis [BR:hit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NTHI0748 (tufB2)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NTHI0748 (tufB2)
  Exosomal proteins of breast cancer cells
   NTHI0748 (tufB2)
  Exosomal proteins of colorectal cancer cells
   NTHI0748 (tufB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
709574..710758
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatacgatacaccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggctcaaatggat
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttcagcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatccttgagttagcaaaccacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagatgtgttctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaactggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggggataacatcaagatgaca
gtaagcttaatccacccaatcgcgatggatcaaggcttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system