KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0748Help
Entry
NTHI0748          CDS       T00248                                 

Gene name
tufB2
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Brite
Translation factors [BR:hit03012]
 Eukaryotic Type
  Elongation factors
   NTHI0748 (tufB2)
 Prokaryotic Type
   NTHI0748 (tufB2)
Mitochondrial biogenesis [BR:hit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NTHI0748 (tufB2)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NTHI0748 (tufB2)
  Exosomal proteins of breast cancer cells
   NTHI0748 (tufB2)
  Exosomal proteins of colorectal cancer cells
   NTHI0748 (tufB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AAX87662
UniProt: Q4QMT5
LinkDB All DBs
Position
709574..710758
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatacgatacaccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggctcaaatggat
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttcagcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatccttgagttagcaaaccacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagatgtgttctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaactggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggggataacatcaagatgaca
gtaagcttaatccacccaatcgcgatggatcaaggcttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system