KEGG   Halioglobus japonicus: BST95_13020Help
Entry
BST95_13020       CDS       T04687                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hja  Halioglobus japonicus
Pathway
hja00020  Citrate cycle (TCA cycle)
hja00270  Cysteine and methionine metabolism
hja00620  Pyruvate metabolism
hja00630  Glyoxylate and dicarboxylate metabolism
hja00680  Methane metabolism
hja01100  Metabolic pathways
hja01110  Biosynthesis of secondary metabolites
hja01120  Microbial metabolism in diverse environments
hja01130  Biosynthesis of antibiotics
hja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hja00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BST95_13020
   00620 Pyruvate metabolism
    BST95_13020
   00630 Glyoxylate and dicarboxylate metabolism
    BST95_13020
  Energy metabolism
   00680 Methane metabolism
    BST95_13020
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BST95_13020
Enzymes [BR:hja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BST95_13020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AQA19026
UniProt: A0A2N5YHV3
LinkDB All DBs
Position
2757725..2758705
Genome map
AA seq 326 aa AA seqDB search
MKTPVRVTVTGAAGQIGYALLFRIASGAMLGDDQPVILQLLDITPAMEALEGVKMELEDC
AFPLLTDIVCTDDPNVGFKDTDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAINDNA
SKDIKVLVVGNPANTNALIAQRNAPDIDPRNFTAMTRLDHNRAMTQIAQKTGKTVNDVKN
MTIWGNHSATQYPDLFNCKVDGDTAINLVDQEWYEGEFIPVVQQRGAAIIKARGASSAAS
AANAAIDHMRSWALGTEGDDWVSMGVYSDGSYGIAEGLIYSFPCRCANGDWSIVQGVEVG
EFSQAKMSATEQELSEERDAVQHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacctgttcgtgtcacagttaccggtgccgcaggccagatcggctacgccctg
ctcttccgcatcgcttccggcgctatgctcggcgatgaccagcccgtcatcctgcagctg
ctggatattacccccgccatggaagcgctcgagggcgttaagatggagctcgaggattgc
gcgttcccgctgctgactgacatcgtctgcaccgatgaccccaatgtaggctttaaagac
accgactacgctctgctggttggcgctcgcccccgtggccccggcatggagcgcaaggac
ctgctggaagccaatgctgcgatcttctccgtccagggtaaggcaattaatgacaacgcc
agcaaggacatcaaggttctggttgtcggcaaccccgccaacaccaacgccctgatcgcc
cagcgcaacgcgccagacatcgatccgcgtaactttaccgcgatgactcgcctggaccac
aaccgcgccatgacccagattgcccagaaaaccggcaaaaccgtcaatgacgtgaagaac
atgaccatctggggcaaccactccgctacccagtatcccgacctgttcaactgcaaggtc
gacggcgatactgcgatcaacctggtcgaccaggaatggtacgaaggtgaattcatccct
gttgttcagcagcgtggtgcggccatcatcaaggcgcgtggtgcttcctctgcagcgtct
gctgcaaacgccgccatcgaccacatgcgctcctgggcgctgggcactgaaggcgacgac
tgggtatccatgggcgtttactccgatggttcctacggcattgccgaaggccttatctac
tccttcccttgccgctgcgccaatggcgactggagcattgttcagggcgttgaggttggc
gaattcagccaggccaagatgtctgccactgagcaggaactgagcgaagagcgcgacgcg
gttcagcacctgctgccgtaa

DBGET integrated database retrieval system