KEGG   Halalkalicoccus jeotgali: HacjB3_10575Help
Entry
HacjB3_10575      CDS       T01271                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00010  Glycolysis / Gluconeogenesis
hje00053  Ascorbate and aldarate metabolism
hje00071  Fatty acid degradation
hje00280  Valine, leucine and isoleucine degradation
hje00310  Lysine degradation
hje00330  Arginine and proline metabolism
hje00340  Histidine metabolism
hje00380  Tryptophan metabolism
hje00410  beta-Alanine metabolism
hje00561  Glycerolipid metabolism
hje00620  Pyruvate metabolism
hje00625  Chloroalkane and chloroalkene degradation
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_10575
   00053 Ascorbate and aldarate metabolism
    HacjB3_10575
   00620 Pyruvate metabolism
    HacjB3_10575
  Lipid metabolism
   00071 Fatty acid degradation
    HacjB3_10575
   00561 Glycerolipid metabolism
    HacjB3_10575
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HacjB3_10575
   00310 Lysine degradation
    HacjB3_10575
   00330 Arginine and proline metabolism
    HacjB3_10575
   00340 Histidine metabolism
    HacjB3_10575
   00380 Tryptophan metabolism
    HacjB3_10575
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HacjB3_10575
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HacjB3_10575
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HacjB3_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADJ15498
UniProt: D8J4N1
LinkDB All DBs
Position
1966813..1968279
Genome map
AA seq 488 aa AA seqDB search
MPELPRLGGDGWESLYLDGEWKTTAERFTIEDPYEREGIASVSKATEDTVDEAYEVAANA
QREWEQIQPQRRAEVIQEAIGVIEERHEELVELLAREAGGTRLKAEIELDIATGMMEVAA
GFPFDSAGQHDRSTIPGKENVVKREPVGVVGVISPWNFPFHLSMRAVAPALALGNAVVLK
PASDTPVTGGLALARIFEEAGLPEGLLNVVPGRGSEIGDRVAGHEIPRVIAFTGSTPVGR
GVASQAAEALSMPAMELGGNNAHIVLEDADLDQAVNAGAFGSFVHQGQVCISINRHLVHE
SLYDDYVAALADKAQSLPVGDPKDGDTVVGPIINESQRDQMIEYIEETVNEGATLEAGGE
FDGLVVEPTVLSGVENDMAAACNEHFGPVAPVIPFADDEEAISLANATEYGLSGSVHSTD
RERAERVADRVDTGMIHINDQPINDEPHIPFGGVGASGIGRYNGEAIKEELTTTKWISIQ
REEREYPF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactaccgcgactgggcggcgacgggtgggaatcgctctatctggacggcgag
tggaaaacgacggcggagcgtttcacaatcgaggacccctacgaacgcgaggggatcgcg
tcggtgtcgaaggcgaccgaggacaccgtcgacgaggcctacgaagtcgcagcgaacgcc
caaagagagtgggagcagattcagccacagcgccgcgcggaggtgattcaggaggcgatc
ggcgtcatcgaggagcgccacgaggaactggtcgagctgctggcccgcgaggccggcggc
acgcgcctgaaagccgagatcgaactcgacatcgccacggggatgatggaggtcgcagcc
ggctttcccttcgattcggcgggccagcacgaccgctcgacgatccccggcaaggagaac
gtcgtcaagcgcgaaccggtcggcgtcgtcggcgtgatctcgccctggaacttcccgttc
cacctctcgatgcgcgcggtcgcgccggcgctggcgctcggtaacgcggtcgtgctcaaa
cccgcttcggacaccccggtcacgggcgggctggcgctcgcgcggatcttcgaggaggcc
ggtcttcccgaggggctactcaacgtcgttcccggccgagggtcggagatcggggatcgc
gtcgcgggccacgagatcccgcgggtgatcgcctttaccggttcgacgccggtcgggcgg
ggcgtcgcgagccaggccgcagaagccctctcgatgcctgcgatggagctcggtggtaac
aacgcccatatcgtcctcgaggacgcggatctcgatcaagccgtgaacgccggtgccttc
ggcagcttcgtccatcaggggcaggtctgcatctcgatcaaccgccatctcgtccacgag
tcgctgtacgacgactacgtcgcggcgctcgcggacaaggcacagtcgcttcccgtcggc
gatcccaaagacggggacaccgtcgtcgggccgatcatcaacgagagtcagcgcgaccag
atgatcgagtacatcgaggagacagtgaacgagggcgcgaccctcgaagccggcggcgag
ttcgacggactggtagtggagccgacggtgctctcgggggtcgaaaacgacatggccgcc
gcctgcaacgagcacttcggccccgtcgcgccggtgatccccttcgcggacgacgaggag
gcgatttcactcgcgaacgccaccgagtacggcctgtccggatcggtgcactcgacggat
cgcgagcgcgcagagcgggtcgcagatcgcgtggacacggggatgatccacatcaacgac
cagccgatcaacgacgagccccacatccccttcggcggcgtgggggcgtcggggatcggc
cggtacaacggcgaggcgatcaaggaggaactgacgacgaccaagtggatctcgatccag
cgcgaggaacgcgagtacccattctag

DBGET integrated database retrieval system