KEGG   Haematospirillum jordaniae: AY555_08480Help
Entry
AY555_08480       CDS       T04366                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hjo  Haematospirillum jordaniae
Brite
Enzymes [BR:hjo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AY555_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1795223..1795822)
Genome map
AA seq 199 aa AA seqDB search
MTFELPPLPYDKTALEPHMSAQTFDFHHGKHHNTYVVNLNNLLKDSPLSGKALEEIVLEA
WKTGNTPVFNNAAQVWNHTFFWHCMKPNGGGAPVGIIAEKITAAFGSYEKFREDFKAAAI
GQFGSGWAWLVLDGGALKIVKTPNAETPMVHGQNALLTVDVWEHAYYLDFQNRRPDFVDT
FLNHLVNWEFVNANLARSC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgaacttccgcccctgccctatgacaagaccgcgctggagccacacatgtcg
gcccagacgtttgactttcaccacggcaagcaccacaacacctatgtcgtaaacctaaac
aatctcctgaaagactcacccctgtcgggtaaagctttggaagagattgtcttggaagca
tggaagacggggaatacgcctgttttcaacaatgcagcccaggtctggaatcacacattc
ttctggcattgtatgaagcccaacgggggcggtgcacctgttggcatcattgcagaaaaa
attacggctgcattcggatcgtatgaaaagttccgtgaagacttcaaggcagcggctatc
ggtcagtttggttcgggctgggcatggcttgttctggatggtggcgccctaaagatcgtc
aagacaccaaatgcagaaacaccgatggtgcacggccagaatgcactactaacggtggat
gtctgggagcatgcctactacctcgacttccagaaccggcgccctgactttgttgatacg
ttcctgaaccacctggttaactgggaattcgtcaacgccaaccttgctcgttcgtgctga

DBGET integrated database retrieval system