KEGG   Halostagnicola larsenii: HALLA_14380Help
Entry
HALLA_14380       CDS       T03008                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
hlr  Halostagnicola larsenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Topo_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AHF99797
UniProt: W0JS62
LinkDB All DBs
Position
1781634..1783100
Genome map
AA seq 488 aa AA seqDB search
MDDVGIAPETGWNAQYIDGEWRQQGERATISVNAPATQETVGEVPRGTTDDLNEAFRVAE
AAQAEWAETPPQERSRIVSTAAQLLEEHMEEFVHLVAIEGGGVQAKGEFEGGAAVGVASH
AAGMALRNRGERSESTVPGKENIVVEEPVGVVGVITPWNFPTVLSMRAVAPALALGNGVV
LKPDEHTPVTGGLLLARVFEMAGLPDGVLNVVTGYGEDIGDHFSGHEVPDVISFTGSTEI
GRRVATNAVENFNFPALELGGNNAHIVTDDADLELAIEAGAFGSFTHQGQVCISINRHLV
HEDVYDDYVAGLAEAAEHIPVGDPLEPESIVGPIINESQFEEMTDYLEETVDAGAVVEAG
GDYDFPYVEPTVLSDVRNEMAAACNEHFGPIAPVIPFSSDEEAIELANDTEMGLSGSVHC
RDITRARAIAKQVETGMIHINDQPINDDPQAPFGGVKSSGMGRYNDRWIADEYTTTRWIS
VQHEPREY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atcgacgacgttggaatcgcgccggaaacggggtggaacgcacagtacatcgacggcgag
tggcgccagcagggcgagcgagcgactatctcggtgaacgcgccggcgacccaggagacg
gtcggcgaggtgccgcgcgggacgaccgacgacctcaacgaggcgttccgagtcgccgaa
gcggcacaggcggaatgggcggagacaccgccacaagagcgctcccgaatcgtctcgacg
gccgcacagctactcgaagagcacatggaggaattcgtccacctcgttgcaatcgaaggc
ggtggcgttcaggcgaagggcgaattcgagggcggagcggccgtcggcgtcgcctcccac
gcggcgggcatggcgcttcgaaatcgcggcgagcgctccgaatcgacggtccccgggaag
gaaaacatcgtcgtcgaggagccggtcggcgtcgtcggagtgatcacgccgtggaacttt
ccgacggtactctcgatgcgggccgtcgcaccggcgctggcgctcggtaacggcgtcgtc
ttaaagcccgacgagcacacccccgtcaccggcggactactgctcgctcgagtgtttgag
atggccgggctgccggacggtgtcttgaacgtcgttacgggctacggcgaagatatcggc
gatcacttctcgggccacgaggtgccggacgtgatctcgtttaccgggtcgactgagatc
ggccgtcgcgtggcgaccaacgcggtcgagaacttcaacttcccagcgctggaactcggc
gggaacaacgcccacatcgtcactgacgacgccgatctcgagttggcgatcgaggccggc
gctttcggttcgttcactcaccagggacaggtctgtatctcgatcaatcgccatctcgtc
cacgaagacgtctacgacgactacgtcgcggggttggccgaagccgccgaacacattcct
gtcggggacccgctcgagcccgaatcgatcgttgggccgatcatcaacgaatcccagttc
gaggagatgaccgactacctcgaggaaaccgtcgacgcgggcgcggtcgtcgaagccggc
ggcgactacgacttcccctacgtcgaaccgacggtgctctcggacgtgaggaacgagatg
gccgcggcctgcaacgagcacttcggaccgatcgcgcccgtgatcccgttctcgagcgac
gaggaagccatcgaactggccaacgacacggagatggggctttcgggttcggtccactgc
cgggacatcactcgagcgcgcgccatcgcaaagcaggtcgaaaccggcatgatccacatc
aacgatcaaccgatcaacgacgatccgcaggcgccgttcggcggcgtcaaatcctccgga
atgggccggtacaacgaccggtggatcgcggacgagtacacgaccacgcgctggatttcc
gtccagcacgagccccgagagtactga

DBGET integrated database retrieval system