KEGG   Halostagnicola larsenii: HALLA_15850Help
Entry
HALLA_15850       CDS       T03008                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hlr  Halostagnicola larsenii
Pathway
hlr00564  Glycerophospholipid metabolism
hlr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hlr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HALLA_15850
Enzymes [BR:hlr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HALLA_15850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 3HCDH_N Pyr_redox NAD_binding_7 Thi4 NAD_binding_8 ApbA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHG00052
UniProt: W0JRX8
LinkDB All DBs
Position
complement(2043198..2044442)
Genome map
AA seq 414 aa AA seqDB search
MNSRTDVLVIGGGATGAGIARDLALREVDVTLVERDGLAAGASGRSHGLLHSGARYAEAD
EAGARECLRENRILRAIGGECVRHTRGLFVQLAGDDPDYFEEKRDACADIGIPTEVVDAN
EIRAELPALNHDVERAMWVPDGVVVPSRLVAANAADARDHGAKILTHAPVTSMTLEEGED
GPGTREISQVSIGGELERTIEPEIVINAAGAYAEGIGELAGVSIPMRPTRGVMVSVEYDA
FEPVLNRCRDPDDGDIIVPHDEEVVLGTTSVPVNDPDEYEQPAWEVERTITECSKLVPDV
SERAITRTWWGVRPLYEPDEAARGGRGISRGFVRLDHADDGVENFLSIVGGKLTTYRQMA
EATADLVCEKLEVDAECLTADVSLPNAEDPVKLDAYVREFDAGGPSDADILGRR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtcggacggacgtactcgttatcggcggcggcgcgaccggcgcggggatcgcc
agggacctcgcgcttcgggaagtagacgtgacgctggtcgaacgcgacgggctcgccgcg
ggcgcgtcgggccgatcccacggccttttacacagcggtgcccggtacgccgaagccgac
gaggcgggtgctcgagagtgtcttcgagagaaccggattctgcgggcgatcggcggcgag
tgcgtccgccacacccgcggtctgttcgtccagctggccggcgacgatccggactacttc
gaggagaaacgcgacgcctgtgcggacatcggaatcccgacggaggtcgtcgacgcgaac
gaaattcgggcggagctgccggcgctcaaccacgacgtcgaacgagcgatgtgggttccc
gacggcgtcgtggttccgtcccgattggtggccgcgaacgcggcggatgcacgcgatcac
ggggcgaaaatcctgacccacgcgccggtcacgtcgatgacgctcgaggagggcgaagac
ggacccggaacgcgggagatttcgcaggtctcgatcggcggcgaactcgagcggaccatc
gaacccgaaatcgtcatcaacgccgccggcgcgtacgccgaggggatcggcgaactggcg
ggcgtgtcgatcccaatgcgcccgaccaggggcgtcatggtctccgtcgagtacgacgcc
ttcgaaccggtgctcaaccgctgtcgcgatcccgacgatggggatatcatcgttccccac
gacgaggaggtcgtcctcgggacgacgagcgttccggtcaacgatccggacgagtacgaa
cagcccgcgtgggaggtcgaacgaacgatcaccgagtgttcgaagctggtccccgacgtg
agcgagcgggcgatcacccgaacctggtggggcgtcagaccgctgtacgaaccggacgaa
gccgcccgtggcggccgcgggatctcgagggggttcgtccgactggaccacgccgacgac
ggcgtcgagaacttcctcagcattgtcggcgggaaactcacgacctaccggcagatggcc
gaggcgaccgccgatctggtctgtgagaaactcgaggtggacgccgagtgtctgacggcc
gatgtctcgcttccgaacgcggaggatccggtgaagttagacgcctacgtccgggagttc
gatgccggcggtccgtcggacgcggatattctcggtcggcgatag

DBGET integrated database retrieval system