Haloferax mediterranei: HFX_0403 Help Entry HFX_0403          CDS       T02129                                  Symbol trxA_1 Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism hme  Haloferax mediterranei Brite KEGG Orthology (KO) [BR:hme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hme03110]     HFX_0403 (trxA_1) Chaperones and folding catalysts [BR:hme03110]  Protein folding catalysts   Protein disulfide isomerase    HFX_0403 (trxA_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_9 TraF DSBA Redoxin Thioredoxin_7 OST3_OST6 Glutaredoxin Glrx-like Phosducin TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  AFK18139 UniProt:  I3R1M9 LinkDB All DBs Position 379397..379663 Genome browser AA seq 88 aa AA seqDB search MTVRLLDFYADWCGPCKTQDPILDDLEGDYEDVEFVKVDVDEEQDVANQYQVRSLPTLIV ENDDGIVDRFVGVTQRDDLESALSEAGA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgactgttcgactcttggacttttacgcggactggtgcggcccttgcaagacgcaggac ccgattctcgacgacctcgaaggcgactacgaggatgtcgagttcgtcaaggttgacgtc gacgaagagcaagacgtggctaaccagtatcaggtgcgctcgcttccaaccctcatcgtc gagaacgacgacggtatcgtcgaccgttttgtgggtgtaactcagcgtgacgacctcgag tcggccctgagcgaagccggcgcgtaa

DBGET integrated database retrieval system