KEGG   Heliobacterium modesticaldum: HM1_1376Help
Entry
HM1_1376          CDS       T00653                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor tu
  KO
K02358  
elongation factor Tu
Organism
hmo  Heliobacterium modesticaldum
Brite
Translation factors [BR:hmo03012]
 Eukaryotic Type
  Elongation factors
   HM1_1376 (tuf)
 Prokaryotic Type
   HM1_1376 (tuf)
Mitochondrial biogenesis [BR:hmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HM1_1376 (tuf)
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HM1_1376 (tuf)
  Exosomal proteins of breast cancer cells
   HM1_1376 (tuf)
  Exosomal proteins of colorectal cancer cells
   HM1_1376 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1400714..1401916
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITLVLSKVGKASFKKYDEIDAAPEERERG
ITINTAHVEYETDNRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVWLNKADMVDDPELMELVEMEVRELLSSYEFPGDDIPIVAGSGLKALE
CGCGKRECEWCGKIWALMDEVDKYIPTPERATDKPFLMPVEDVFTITGRGTVATGRVERG
TIKVGEEVEIVGLAESTRKTVVTGVEMFRKLLDFAQAGDNIGTLLRGVERKDIERGQVLA
KPGSIKPHTKFTAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGFIELPEGVEMCMPG
DNIKMTIELGKTIAIEEGLRFAIREGGRTVGAGVVTGIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagccaaattcgagcgcaccaagccgcacgtgaacatcggcaccatcggtcac
gttgaccacggcaaaaccaccactaccgctgctatcaccctggttctctccaaagtaggc
aaagcctccttcaaaaagtacgacgaaatcgacgctgcgcccgaagagcgtgaacgcggc
atcaccatcaacaccgcccacgttgagtatgaaaccgacaaccgtcactacgctcacgtg
gactgccccggtcacgccgactacatcaaaaacatgatcaccggtgctgctcagatggac
ggcgccatcctggttgtgtctgctgctgatggtcccatgccccagacccgtgaacacatc
ctcctggcccgccaggtcggcgtaccctacattgttgtctggctgaacaaagccgacatg
gtagacgatcccgaactgatggaactggtcgagatggaagtgcgcgagctcctctcctcc
tacgagttccctggcgacgacatccccatcgtggccggttccggcctgaaagccctcgag
tgcggctgcggcaagcgcgagtgcgaatggtgcggtaagatctgggcgctcatggacgaa
gtcgacaagtacatccccacccccgagcgcgccaccgacaagcccttcctgatgccggtt
gaagacgtcttcaccatcaccgggcgcggcaccgtcgccaccggccgtgtcgagcgcggt
accatcaaagtcggcgaggaagtcgagattgtcggtttggccgagtccacccgcaagacc
gtcgtcaccggcgttgaaatgttccgcaagctcctcgacttcgcccaagccggcgacaac
atcggcaccctgctgcgcggtgttgaacggaaagacatcgagcgcggccaagttctggct
aaacccggttccatcaagccccacaccaaattcaccgctgaggtctacgtcctgtccaaa
gaggagggcggccgccacaccccgttcttcaacggctatcgtccccagttctacttccgg
accaccgacgtaaccggcttcatcgagctgcctgaaggcgttgaaatgtgcatgcctggc
gacaacatcaagatgaccatcgagctcggcaaaaccatcgccatcgaagaaggcctccgc
ttcgctatccgcgaaggcggccggactgtaggcgccggcgttgtcaccggtatcatcgag
taa

DBGET integrated database retrieval system