KEGG   Hippea maritima: Hipma_0589Help
Entry
Hipma_0589        CDS       T01456                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00020  Citrate cycle (TCA cycle)
hmr00620  Pyruvate metabolism
hmr00633  Nitrotoluene degradation
hmr00640  Propanoate metabolism
hmr00650  Butanoate metabolism
hmr00680  Methane metabolism
hmr01100  Metabolic pathways
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Module
hmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0589
   00020 Citrate cycle (TCA cycle)
    Hipma_0589
   00620 Pyruvate metabolism
    Hipma_0589
   00640 Propanoate metabolism
    Hipma_0589
   00650 Butanoate metabolism
    Hipma_0589
  Energy metabolism
   00680 Methane metabolism
    Hipma_0589
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hipma_0589
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hipma_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEA33559
UniProt: F2LUV4
LinkDB All DBs
Position
complement(597285..598475)
Genome map
AA seq 396 aa AA seqDB search
MGKKVALTGNEAAAHAMRQINPDVIAAFPITPSTPVPQAVAQFIADGEMDTELVTVESEH
SAMSACIGAAAAGARVMTATSANGYALMWEMLYIASGMRLPIVMAVAARALSAPLNIHGD
HSDIMGGRDTGWIQLISENSQEAYDNLIQAIKIAENEKVITPALAAFDGFNVSHAIEIWE
LEDDAAVKEFIGKYEAKFPLLNTDDPITHGAWAPPDWYFEHKMNQLKGLLNAKDVVTQVG
KDFGKAFGREYGLYEAYKLDDADFVVVAAGSVCGTTKDVVDNLRENGVKAGLLKIRLFRP
FPFKDIADALQSAKAIAVLDRVSPSGAQGGPLFNEIRSALYDTDTRAPVINYTYGLGGRD
TQPRHINSVYETLKKIVDTGKVEKQFDCLNLRGAWG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaagtagcattgacgggaaatgaggctgccgcccatgcaatgagacagatc
aatccagatgttatagcagcctttccaataacaccttcaacacctgtacctcaagccgtg
gctcagtttatagctgacggtgaaatggacacagagcttgttactgttgaaagtgaacat
tctgcaatgagtgcatgtatcggcgcagcagcagccggtgcaagggttatgacagccaca
agcgcaaacggttatgcacttatgtgggagatgctatacatagcaagcggaatgaggctt
ccaattgttatggcagttgcagcaagagctctttctgccccactaaacatacacggtgac
cattcagacataatgggtggaagggatacaggatggattcaattaatatctgaaaattcc
caagaagcttatgataatttaattcaagcaataaagatagctgaaaacgagaaagtaatt
actccagcattagctgcatttgatggtttcaatgtatctcatgctattgaaatatgggaa
cttgaggatgatgcagctgttaaggaatttataggaaaatatgaggctaagtttccacta
ctcaatactgatgatcctataactcacggtgcctgggctccaccagattggtacttcgaa
cacaaaatgaatcaacttaaaggtcttttaaatgcaaaagatgtcgtgactcaggtagga
aaagattttggcaaggcttttggaagggagtatggactttatgaggcatacaaattagac
gatgcagactttgttgttgtcgctgcaggctctgtatgcggcacaacaaaggatgttgtg
gataatttaagagaaaacggcgttaaagctggcttgttaaagataagactattcagacca
ttcccattcaaagatattgcagatgccctgcaatctgctaaagccatagcggttttggat
agggtgtcaccatcaggtgctcaaggtggacccctattcaacgagataagaagcgctttg
tatgatacagatacaagggctcctgtaatcaactacacatacggacttggaggaagagat
acccagcccaggcatataaactctgtgtacgaaacattaaagaaaatagttgatacgggt
aaggttgaaaaacagttcgattgtctaaacctaagaggagcatgggggtaa

DBGET integrated database retrieval system