KEGG   Hyphomonas neptunium: HNE_2417Help
Entry
HNE_2417          CDS       T00397                                 

Gene name
alr2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hne  Hyphomonas neptunium
Pathway
hne00473  D-Alanine metabolism
hne01100  Metabolic pathways
hne01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HNE_2417 (alr2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HNE_2417 (alr2)
Enzymes [BR:hne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HNE_2417 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:hne01011]
 Precursor biosynthesis
  Racemase
   HNE_2417 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABI77737
UniProt: Q0BZI1
LinkDB All DBs
Position
complement(2524367..2525557)
Genome map
AA seq 396 aa AA seqDB search
MVTEAAAPASHFQIEHTSTWHPSTDEAGRLTIDMGAIAANYRRLRAMHPAARVAAVVKAD
AYGLDATQIAPMLAGQGARDFFVAHLAEALVLKPLLPPDAVLFVLNGLAPGSEPLCAEAG
ILPVLNTPEQARAWYTLAVNKAHPVPAALQVDTGMSRLGLSEGELNDVLGWPSFAGQVNI
CLLMTHMACADTPGAPANADQMRRFADFAARLPSVPRSLANSAAAMFLPEAAGDVLRPGL
VLYGVDPGAGGVPKMQPAIALEARIIQLRHIPAGAGVGYGFDYIADRPLRVATLSAGYAD
GWPRALSNGGATWFAGHRLPILGRVSMDSCMVDVTNLPEGSIRPGDCVELIGPHQSVNDL
ARQLATTPHEILTSLGRRFTRSYINPPSLHGEEAQS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtcactgaggcagccgcgccggcgtctcacttccagattgagcatacaagcacctgg
catccgtctacggatgaggccggccggctgacaattgatatgggcgccatcgccgccaat
taccgccgtctgcgtgcaatgcacccggccgcgcgcgtcgccgccgttgtgaaggccgat
gcctatggcctcgatgccacgcagatcgcccccatgctggccgggcagggcgcgcgggac
ttcttcgttgcccatctcgccgaagcgctggttctgaaaccgctcctgccgcccgatgct
gtcctcttcgtcctcaacggcctcgcccccggcagtgaaccgctttgcgccgaggcgggt
atattgcccgtactcaacacgcctgaacaggcgcgcgcctggtacacgctggcggtgaac
aaggcccatccggttcccgccgcgctccaggtagacaccggcatgtcccgcctcggcctc
agcgagggtgaacttaacgacgttcttggctggccaagctttgccggtcaggtaaacatc
tgcctcctgatgacgcatatggcctgcgcagacacgcccggcgcccccgccaacgcagat
cagatgcgtcgcttcgccgactttgcagcgcgcctgccatcggtcccccgctccctcgcc
aattccgctgccgcgatgttccttccggaggcagccggcgacgtcctgcgccccggcctc
gtcctctacggcgtcgatccgggcgcaggcggcgtgccgaaaatgcagccagcgatcgct
ctagaagcgcggatcatccagctccgccacattccagcgggtgccggagtcggctacggc
ttcgactacattgcggaccgccccctccgcgtcgctacgctttccgctggctacgcagac
ggttggccccgcgcgctcagcaacgggggcgccacctggttcgcaggccaccgcctgccc
atcctcgggcgcgtctccatggacagctgcatggtggacgtgacgaaccttccagaagga
agtatccgccccggagactgtgtggagctcatcggtccgcaccagtccgtcaacgatctc
gcccgccaactcgccaccaccccccacgaaatcctcaccagcctggggcgccgtttcacc
cgcagctatatcaaccccccgtccttgcacggagaagaggcgcagtcatga

DBGET integrated database retrieval system